DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and Ttpa

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_037180.1 Gene:Ttpa / 25571 RGDID:3915 Length:278 Species:Rattus norvegicus


Alignment Length:233 Identity:67/233 - (28%)
Similarity:113/233 - (48%) Gaps:8/233 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHMSTQLDYLEPR--LGDLIDQGYIFAVPQRDK 116
            |.||||||||:.|.:.:|.:.:..|...|...|.:|..   |.||  || |:..||...:..||.
  Rat    49 DAFLLRFLRARDFDLDLAWRLMKNY
YKWRAECPELSAD---LHPRSILG-LLKAGYHGVLRSRDP 109

  Fly   117 HGRRVVVINAKGLNPKIHTSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPT 181
            .|.||::......:||:.|:.|..:...:|.|.::::.|||..|:..:.|..|...:|.....|:
  Rat   110 TGSRVLIYRISYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQISHAFQITPS 174

  Fly   182 EFARIFKWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSE-KELMKSVDQG 245
            ...:|......|.|::.:.|||||.|.....:...:|..::.|:|.|:.::|:. |..:......
  Rat   175 VAKKIAAVVTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKGRIHLHGNNYKSSLLQHFPD 239

  Fly   246 CLPLEMGG-KVPMREMIELWKQELATKRDLILGLDKSI 282
            .||||.|| :..|.::.:.|...:....|.:..:.::|
  Rat   240 ILPLEYGGNESSMEDICQEWTNFIMKSEDYLSSISETI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 11/23 (48%)
SEC14 101..254 CDD:238099 43/154 (28%)
TtpaNP_037180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CRAL_TRIO_N 25..73 CDD:215024 11/23 (48%)
CRAL_TRIO 99..248 CDD:395525 41/148 (28%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.