DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and CG30339

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:327 Identity:88/327 - (26%)
Similarity:143/327 - (43%) Gaps:38/327 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LPEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTL 75
            |...|.:||:.||.|........|:.||:|:||...|: .|.||.||:.|||..|||:...:..|
  Fly     7 LSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLR-ARQDDQFLVGFLRGCKFSLEKTKSKL 70

  Fly    76 LKYLNIRRTFPHMSTQLDYLEPRLGD-----LIDQGYIFAVPQR-DKHGRRVVVINAKGLNPKIH 134
            ..:..|:...|.:      ...||.|     |...|....:|:. ...|.|:.:.|.:..:||..
  Fly    71 DHFYTIKTLMPEL------FGKRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKEF 129

  Fly   135 TSCDQAKAH-FLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRH 198
            ...|..:.. .:|.:.:.||..:.|:|...:.|.|.::.:.:...:.|...|:..:.|::.|.|.
  Fly   130 KLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRL 194

  Fly   199 KEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKELMKSVDQGCLPLEMGGK------VPM 257
            |.:||||.|.....|::..|:.:.||::.|..:|.:.::|.:.:.:..||.|.||.      :..
  Fly   195 KGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVYKNLEQLNEVIPREYLPEEYGGNNGRIADIQA 259

  Fly   258 REMIELWKQELATKRDLILGLDKSILRSDRGIQRRSSFNAGKASTGGPNFVSQIESIEGSFRKLE 322
            ....:|...|.....|...|:|:. ||..:.:...|.|.|                 |||||||:
  Fly   260 EAEKKLLSYESYFAEDSQYGVDEQ-LRPGKRVNADSIFGA-----------------EGSFRKLD 306

  Fly   323 FD 324
            .|
  Fly   307 ID 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 19/46 (41%)
SEC14 101..254 CDD:238099 39/159 (25%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 18/42 (43%)
CRAL_TRIO 109..250 CDD:279044 35/140 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.