DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and Rlbp1

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001166954.1 Gene:Rlbp1 / 19771 MGIID:97930 Length:317 Species:Mus musculus


Alignment Length:269 Identity:83/269 - (30%)
Similarity:134/269 - (49%) Gaps:17/269 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QDQGETTG----LPEALLKIAKRELREDRCTREQSLEQLRNWV----AKNEDL-----QNVRC-D 53
            :|.|...|    ||...|:.||.||.|...|||:::.:|:..|    |..|:|     :.|:. |
Mouse    28 KDHGPVFGPCSQLPRHTLQKAKDELNEKEETREEAVRELQELVQAQAASGEELALAVAERVQARD 92

  Fly    54 DTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHG 118
            ..|||||:||:||.|..|.:.|..|:|.|..:|.:...|..  ..|...|:.||...:..|||:|
Mouse    93 SAFLLRFIRARKFDVGRAYELLKGYVNFRLQYPELFDSLSM--EALRCTIEAGYPGVLSSRDKYG 155

  Fly   119 RRVVVINAKGLNPKIHTSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEF 183
            |.|::.|.:..:.:..|..:..:|:....|.|:|::||||.|...|.:|.|.|........|::.
Mouse   156 RVVMLFNIENWHCEEVTFDEILQAYCFILEKLLENEETQINGFCIVENFKGFTMQQAAGLRPSDL 220

  Fly   184 ARIFKWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKE-LMKSVDQGCL 247
            .::....:.|.|.|.|.||.|:.|.......:.||..:.:|:..|:.::|.:.: ..:.:|:..|
Mouse   221 KKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENIL 285

  Fly   248 PLEMGGKVP 256
            |.:.||.:|
Mouse   286 PADFGGTLP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 20/56 (36%)
SEC14 101..254 CDD:238099 42/153 (27%)
Rlbp1NP_001166954.1 CRAL_TRIO_N 60..117 CDD:215024 20/56 (36%)
CRAL_TRIO 143..292 CDD:395525 41/148 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8767
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.