DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and F28H7.8

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_505746.2 Gene:F28H7.8 / 185099 WormBaseID:WBGene00009241 Length:410 Species:Caenorhabditis elegans


Alignment Length:255 Identity:61/255 - (23%)
Similarity:112/255 - (43%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EQSLEQLRNWVAKNEDLQNVRCDDTF-LLRFLRAKKFSVPMAEQTLLKYLNIRR----TFPHMST 90
            :.::||:|..|:   |:.:.|.|..: :||:|::..|::|.....|.|:|..|:    ..|...:
 Worm    16 DAAIEQVRLQVS---DVIDPRYDTKWNMLRWLQSNDFNIPKTVHLLKKHLKWRKDRKLDEPESQS 77

  Fly    91 QLDYLEPRLG----DLIDQGYIFAVPQRDKHGRRVVV------INAKGLNPKIHTSCDQAKAHFL 145
            .|.:.:.|..    |:|.       |||.:.|.|:||      |:..||...:..: :.....|.
 Worm    78 LLQFSDARRKHAPIDIIG-------PQRKEDGDRLVVVDRAGRIDVSGLMKSVQPT-EYLHEMFR 134

  Fly   146 TYE-----CLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARI---FKWGEQSLPMRHKE-- 200
            ::|     .:..:.||.:....|.     :......|::||....:   |:...|.:...::|  
 Worm   135 SFEEIQRRLMKMEAETGVQCYMHY-----IFDLEALNFDPTLLGVVNGPFRVSWQLVGQHYREFI 194

  Fly   201 --IHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGS--EKELMKSVDQGCLPLEMGGKVP 256
              ..:||.||.:..|...:...:..:.|.|::..||  ::||:..||:.|||...||.:|
 Worm   195 DKFIVINSPSYINVLWSALSPFIPEQSKQRIVFAGSNWKEELLDIVDKECLPERYGGMIP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 13/47 (28%)
SEC14 101..254 CDD:238099 40/172 (23%)
F28H7.8NP_505746.2 CRAL_TRIO_N 16..61 CDD:215024 13/47 (28%)
SEC14 93..251 CDD:214706 38/170 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.