DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and R03A10.5

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 / 181634 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans


Alignment Length:89 Identity:19/89 - (21%)
Similarity:35/89 - (39%) Gaps:21/89 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VQDQGETTGLPEALLKIAKRELREDRCTREQSLEQLRNWVAKNED--LQNVRCDDTFLLRFLRAK 64
            |....:|..:|...:.:..:.::..|        :||.||..|.:  |.....|:..:..|..||
 Worm   274 VVKNAQTVNVPYGKIHVVTKFIKAGR--------KLRWWVRGNRNFGLGVFHSDEEQVADFFIAK 330

  Fly    65 KFS-----------VPMAEQTLLK 77
            :.|           |||.::.::|
 Worm   331 QVSPCFPWMPGPTLVPMEDEVIVK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 15/60 (25%)
SEC14 101..254 CDD:238099
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.