DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and C34C12.6

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_497717.2 Gene:C34C12.6 / 175452 WormBaseID:WBGene00007925 Length:400 Species:Caenorhabditis elegans


Alignment Length:194 Identity:41/194 - (21%)
Similarity:73/194 - (37%) Gaps:26/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 SCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKE 200
            |.|:....|:    ::.|..|     .::.|:....:.::..|.    .|...| :...|...:.
 Worm   160 SADKGPVQFI----VIFDLNT-----VNITDYVNPMSGYMKLWQ----IRSELW-QDWFPEMVQR 210

  Fly   201 IHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKELM-KSVDQGCLPLEMGGK----VPMREM 260
            |:|.|.|..|..|....:..:|.:...|:.|...:.:|. |.:....:|.|.||:    ||..:.
 Worm   211 IYLTNPPRLLGLLWKVARVFLSEENLKRIEIISDKSDLAGKFLPPWLVPKEYGGEFVNTVPPGDE 275

  Fly   261 IELWKQELATKRDLILGLDKSILRSDRGIQRRSSFNAGKASTGGPNFVSQIESIEGSFRKLEFD 324
            ..:..:...|..|.......   ..:.||.|..|  :.|..:....||.:|:...|  :||.:|
 Worm   276 TGVSVRRKITSADYYKPYQH---YKEHGIDRPKS--SHKDVSPAEKFVFKIQVPNG--KKLLWD 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024
SEC14 101..254 CDD:238099 24/118 (20%)
C34C12.6NP_497717.2 SEC14 91..265 CDD:214706 24/118 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.