DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and H41C03.1

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_495168.1 Gene:H41C03.1 / 173994 WormBaseID:WBGene00019268 Length:396 Species:Caenorhabditis elegans


Alignment Length:239 Identity:49/239 - (20%)
Similarity:90/239 - (37%) Gaps:46/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EDLQNVRCDDTF-LLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHMSTQLDYLEPRLGD--LIDQG 106
            :||.....|..| |||:.:...|....|...|.::|..|:.:     .||.:...:.|  ::.:.
 Worm    17 KDLLTEYYDTDFNLLRWAQGYGFDKDEALAELRRHLRFRQYY-----DLDNILTNVPDHPILKKY 76

  Fly   107 Y-IFAVPQRDKHGRRVVV-----INAKGLNPKIHTSCDQAKAHFLTYE---CLMEDQE----TQI 158
            : :..|.:..|..:.:|:     |:..|:...:|.| |.....|...|   ..|.:.|    ||.
 Worm    77 FPLGLVGETGKDNQLLVIECAGRIDLMGILKSVHLS-DFLIQRFKFQEKMLAAMNEMERKYGTQC 140

  Fly   159 TGLTHVGDFAG----------VTTAHVTNWNPTEFARIFKWGEQSLPMRHKEIHLINVPSTLKWL 213
            : :.::.|..|          ||..:...|     |.::    .:.|.....:.|||.||.:..|
 Worm   141 S-VIYILDLEGLKFDPALISIVTGPYRILW-----ASVY----TAYPEWINTLFLINAPSFMTLL 195

  Fly   214 IDFVKNRVSSKMKNRLIIYGSEKELMKSVDQGC----LPLEMGG 253
            ...:...:..:.:|::.|.....:...||.:..    :|...||
 Worm   196 WKAIGPLLPERTRNKVRICSGNSDWKTSVQKHAHIDNIPKHWGG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 10/33 (30%)
SEC14 101..254 CDD:238099 35/182 (19%)
H41C03.1NP_495168.1 SEC14 69..242 CDD:214706 35/182 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.