DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cralbp and Sec14l4

DIOPT Version :9

Sequence 1:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_666125.1 Gene:Sec14l4 / 103655 MGIID:2144095 Length:403 Species:Mus musculus


Alignment Length:259 Identity:58/259 - (22%)
Similarity:109/259 - (42%) Gaps:62/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 REQSLEQLRNWVAKNEDLQNV-----RCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHMS 89
            ::::|.:.|      |.||::     :.||.||||:|||:.|.:..:|..|.|::..|.. .::.
Mouse    12 QQEALARFR------ETLQDLLPTLPKADDYFLLRWLRARNFDLKKSEDMLRKHVEFRNQ-QNLD 69

  Fly    90 TQLDYLEPRLGDLID------------------------QGYIFAVPQRDKHGRRVVVINAKGLN 130
            ..|.:..|.:..|.|                        :|...:..::|...:|:.|       
Mouse    70 QILTWQAPEVIQLYDSGGLSGYDYEGCPVWFDIIGTMDPKGLFMSASKQDMIRKRIKV------- 127

  Fly   131 PKIHTSCDQAKAHFLTYECLMEDQE--TQITGLTHVGDFAGVTTAHVTNWNPT--EFARIFKWGE 191
                  |:     .|.:||.::.|:  .:|..:..|.|..|::..|:  |.|.  .:.:.|...|
Mouse   128 ------CE-----MLLHECELQSQKLGRKIERMVMVFDMEGLSLRHL--WKPAVEVYQQFFAILE 179

  Fly   192 QSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGS--EKELMKSVDQGCLPLEMGG 253
            .:.|...|.:.:|..|.......:.||:.:..:.:.:::|.|.  ::||:|.|....||:|.||
Mouse   180 ANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKIVILGGNWKQELVKFVSPDQLPVEFGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 17/51 (33%)
SEC14 101..254 CDD:238099 37/183 (20%)
Sec14l4NP_666125.1 CRAL_TRIO_N 13..59 CDD:215024 17/51 (33%)
SEC14 77..244 CDD:214706 38/187 (20%)
GOLD_2 284..379 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2738
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.