DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and YDA

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001319310.1 Gene:YDA / 842674 AraportID:AT1G63700 Length:883 Species:Arabidopsis thaliana


Alignment Length:567 Identity:125/567 - (22%)
Similarity:224/567 - (39%) Gaps:172/567 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKHHRLPLPELHDDKHRHKQCNGENSNRFRPPKYKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAH 66
            ::.||||||.|                             .:.|          :|..:.:..| 
plant   353 QQSHRLPLPPL-----------------------------LISN----------TCPFSPTYSA- 377

  Fly    67 AISFRDAGCSDSSTLPSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVK 131
                     :.|.::|.||.:||.:....|.:::  .||  ||.||||.|:...:...|::.|:|
plant   378 ---------ATSPSVPRSPARAEATVSPGSRWKK--GRL--LGMGSFGHVYLGFNSESGEMCAMK 429

  Fly   132 -------------ISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQME-LC 182
                         .::||  |::...  |..:|       |:|.:::..:....|:||:.:| :.
plant   430 EVTLCSDDPKSRESAQQL--GQEISV--LSRLR-------HQNIVQYYGSETVDDKLYIYLEYVS 483

  Fly   183 RESLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGLV 247
            ..|:.:.|....:..|..|.:....:|.||..||.:|.:|.|||..|:|: :.....|:||||:.
plant   484 GGSIYKLLQEYGQFGENAIRNYTQQILSGLAYLHAKNTVHRDIKGANILV-DPHGRVKVADFGMA 547

  Fly   248 IDVDRANSHHATEGDSRYMAPEILQGH--FSKAADIFSLGIAMLELACYMDLPSNGPLWHELRHG 310
            ..:...:...:.:|...:||||:::..  .:.|.||:|||..:||:|      :..|.|.:. .|
plant   548 KHITAQSGPLSFKGSPYWMAPEVIKNSNGSNLAVDIWSLGCTVLEMA------TTKPPWSQY-EG 605

  Fly   311 I-----------LPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHPKLQYLQKKRKSLMN- 363
            :           || :..:.:|.|.:..::..::.:||.||||.|||.|..::.:....:.::: 
plant   606 VPAMFKIGNSKELP-DIPDHLSEEGKDFVRKCLQRNPANRPTAAQLLDHAFVRNVMPMERPIVSG 669

  Fly   364 -----FSMLSRSFRRSRRAVWGRMCNWKTAAFRYLLYFLEVLHL-CKPITASQPNINI------- 415
                 .::.|.:.|.                       |::.|. ..|...|:...|.       
plant   670 EPAEAMNVASSTMRS-----------------------LDIGHARSLPCLDSEDATNYQQKGLKH 711

  Fly   416 -----VPSSPSSKGVPLVPQVEFQLVGSTPIANRDCYASDFLSG-EDPLDLSNQGSPNVI--NST 472
                 :..||.:...|:.|      ||| ||.:..   |..:|| ..|..:|   ||:.:  :||
plant   712 GSGFSISQSPRNMSCPISP------VGS-PIFHSH---SPHISGRRSPSPIS---SPHALSGSST 763

  Fly   473 PLN--------TNQGKSRLDLLKNNVDSM------GRYVHVHDFESP 505
            ||.        .:|.::.::.|...:.|.      |.:.....|:.|
plant   764 PLTGCGGAIPFHHQRQTTVNFLHEGIGSSRSPGSGGNFYTNSFFQEP 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 74/275 (27%)
Pkinase 102..349 CDD:278497 74/273 (27%)
YDANP_001319310.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.