DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and NEK1

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001185224.1 Gene:NEK1 / 841893 AraportID:AT1G54510 Length:612 Species:Arabidopsis thaliana


Alignment Length:391 Identity:91/391 - (23%)
Similarity:173/391 - (44%) Gaps:94/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FERLAKLGEGSFGEVFQVRDRSDGQLYAVK---ISKQLFRGEQYRAERLEEVRRYEEFSGHENCI 163
            :|.|.::|:||||....||.:.:.:.|.:|   :::|..|..:...:.:|.:.:..    |...:
plant     4 YEFLEQIGKGSFGSALLVRHKHEKKKYVLKKIRLARQTQRTRRSAHQEMELISKMR----HPFIV 64

  Fly   164 RFIRAW-EQYDRLYMQMELCR-ESLEQYLLRCQRI--PEERIWHILLDLLRGLKSLHDRNLIHLD 224
            .:..:| |:...:.:.:..|. ..:.|.:.:...:  .||::...|:.||.||:.||..:::|.|
plant    65 EYKDSWVEKACYVCIVIGYCEGGDMAQAIKKSNGVHFQEEKLCKWLVQLLMGLEYLHSNHILHRD 129

  Fly   225 IKLDNVLIGEDDETCKLADFGL--VIDVDRANSHHATEGDSRYMAPEILQG-HFSKAADIFSLGI 286
            :|..|:.:.::.: .:|.||||  ::..|...|  :..|...||.||:|.. .:...:||:|||.
plant   130 VKCSNIFLTKEQD-IRLGDFGLAKILTSDDLTS--SVVGTPSYMCPELLADIPYGSKSDIWSLGC 191

  Fly   287 AMLELACYM-------DLPSNGPLWHELRHGILPEEFINKISLELQS------------VIKSMM 332
            .:.|:| |:       |:                :..||||:..:.|            ::|||:
plant   192 CIYEMA-YLKPAFKAFDM----------------QALINKINKTIVSPLPAKYSGPFRGLVKSML 239

  Fly   333 KPDPAQRPTAEQLLSHPKLQ-YL--------QKKRKSL-------------MNFS---MLSRSF- 371
            :.:|..||:|..||.||.|| |:        ..:||:|             .:||   :...:| 
plant   240 RKNPEVRPSASDLLRHPHLQPYVLDVKLRLNNLRRKTLPPELPSSKRIMKKAHFSEPAVTCPAFG 304

  Fly   372 RRSRRAVWG-RMCNWK-----TAAFRYLLYFLEVLH---------LCKPITASQPNINIVPSSPS 421
            .|..|::|. |..|.:     .::.:.:...:..|.         :||.:::|...::..|.:.|
plant   305 ERQHRSLWNDRALNPEAEEDTASSIKCISRRISDLSIESSSKGTLICKQVSSSACKVSKYPLAKS 369

  Fly   422 S 422
            |
plant   370 S 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 68/275 (25%)
Pkinase 102..349 CDD:278497 68/275 (25%)
NEK1NP_001185224.1 STKc_Nek 3..258 CDD:270855 70/277 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.