DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and AT1G51830

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001323323.1 Gene:AT1G51830 / 841610 AraportID:AT1G51830 Length:700 Species:Arabidopsis thaliana


Alignment Length:403 Identity:89/403 - (22%)
Similarity:156/403 - (38%) Gaps:129/403 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FERLAKLGEGSFGEVFQVRDRSDGQLYAVKI----SKQLFRGEQYRAERLEEVRRYEEFSGHENC 162
            |:|:  ||:|.||.|:........|: |:||    |.|.::  |::|| :|.:.|..    |:|.
plant   395 FQRV--LGKGGFGIVYHGLVNGTEQV-AIKILSHSSSQGYK--QFKAE-VELLLRVH----HKNL 449

  Fly   163 IRFIRAWEQYDRL-----YMQMELCRESL----EQYLLRCQRIPEERIW----HILLDLLRGLKS 214
            :..:...::.:.|     ||.....:|.:    ..::|.         |    .|:::..:||:.
plant   450 VGLVGYCDEGENLALIYEYMANGDLKEHMSGTRNHFILN---------WGTRLKIVVESAQGLEY 505

  Fly   215 LHD---RNLIHLDIKLDNVLIGEDDETCKLADFGLVIDVDRANSHH---ATEGDSRYMAPEILQG 273
            ||:   ..::|.|||..|:|:.|..: .|||||||..........|   |..|...|:.||..:.
plant   506 LHNGCKPLMVHRDIKTTNILLNEQFD-AKLADFGLSRSFPIEGETHVSTAVAGTPGYLDPEYYRT 569

  Fly   274 HF-SKAADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPA 337
            :: ::.:|::|.|:.:||:.      :|.|:....|......|::.::.  .:..||::|.|.  
plant   570 NWLTEKSDVYSFGVVLLEII------TNQPVIDPRREKPHIAEWVGEVL--TKGDIKNIMDPS-- 624

  Fly   338 QRPTAEQLLSHPKLQYLQKKRKSLMNFSMLSRSFRRSRRAVWGRMCNWKTAAFRYLLYFLEVLHL 402
                                    :|....|.|.             ||.         :|:...
plant   625 ------------------------LNGDYDSTSV-------------WKA---------VELAMC 643

  Fly   403 C-KPITASQPNINIVPSSPSSKGVPLVPQVEFQLVGSTPIANRDCYASDFLSGEDPLDLSNQGSP 466
            | .|.:|.:||::               ||..:|        .:|..|:...|....|:.::||.
plant   644 CLNPSSARRPNMS---------------QVVIEL--------NECLTSENSRGGAIRDMDSEGSI 685

  Fly   467 NV-----INSTPL 474
            .|     ...|||
plant   686 EVSLTFGTEVTPL 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 65/270 (24%)
Pkinase 102..349 CDD:278497 65/270 (24%)
AT1G51830NP_001323323.1 Malectin_like <17..164 CDD:403886
PLN00113 206..>298 CDD:215061
leucine-rich repeat 225..245 CDD:275380
leucine-rich repeat 246..269 CDD:275380
leucine-rich repeat 270..294 CDD:275380
STKc_IRAK 399..664 CDD:270968 77/361 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.