DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and CKL13

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_171939.1 Gene:CKL13 / 839520 AraportID:AT1G04440 Length:468 Species:Arabidopsis thaliana


Alignment Length:500 Identity:110/500 - (22%)
Similarity:178/500 - (35%) Gaps:132/500 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYEE---------------- 155
            |||.|||||:|...:...|:..|||:       |..||...:  ..||.                
plant    14 KLGSGSFGEIFLGVNVQTGEEVAVKL-------EPLRARHPQ--LHYESKLYMLLQGGTGIPHLK 69

  Fly   156 ---FSGHENCIRFIRAWEQYDRLYMQMELCRESLEQYLLRCQRIPEERIWHILLD-LLRGLKSLH 216
               ..|..||              |.::|...|:|::...|.|....:...:|.| ::..::.:|
plant    70 WFGVEGEFNC--------------MVIDLLGPSMEEFFNYCSRSFSLKTVLMLADQMINRVEYMH 120

  Fly   217 DRNLIHLDIKLDNVL--IGEDDETCKLADFGLVIDVDRANSH-HA-------TEGDSRYMAPEIL 271
            .:..:|.|||.||.|  :|.......:.|:||........:| |.       ..|.:||.:....
plant   121 VKGFLHRDIKPDNFLMGLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYASVNTH 185

  Fly   272 QG-HFSKAADIFSLGIAMLELACYM---DLPSNGPLWHELRHGILPEEFINKISLELQ-SVIKSM 331
            .| ..|:..|:.|||..::    |.   .||     |..||.|...::: :|||.:.: :.::.:
plant   186 LGIEQSRRDDLESLGYLLM----YFLRGSLP-----WQGLRAGTKKQKY-DKISEKKRLTPVEVL 240

  Fly   332 MKPDPAQRPTAEQLLSHPKLQYLQKKRKSLMNFSMLSRSFRR---SRRAVWGRMCNWKTAAFRYL 393
            .|..|.:  .....|....|::..|.     ::|.|.|.||.   .....:..:.:|  ...||.
plant   241 CKNFPPE--FTSYFLYVRSLRFEDKP-----DYSYLKRLFRDLFIREGYQFDYVFDW--TILRYP 296

  Fly   394 LYFLEVLHLCKPITASQPNINI-VPSSPSSKGVPLVPQVEFQLVG-------------------- 437
            .:........||....:|.:|| |||:..::..|:......:..|                    
plant   297 QFGSSSSSNSKPRPTLRPAMNIPVPSADKAEKPPIGQDSRERFSGVFEAYTRRNGSGTGVQADQS 361

  Fly   438 STPIANRDCYASDFLSGEDPLDLSNQGSPNVINSTPLNTNQGKSRLDLLKNNV----------DS 492
            |.|..:.:..||.        |..||..||     .|:.|...||..:..::|          :.
plant   362 SRPRTSENVLASK--------DTQNQERPN-----SLSRNLSSSRKAIAGSSVRATSSADFTENR 413

  Fly   493 MGRYVHVHDFES--------PCSALSSAKVLDTSSFRRKKLFVLE 529
            :.|.:..:|..|        |.|:..:.|...|.:.|...|..||
plant   414 LSRLIPNNDRSSTTLRTQFAPSSSSVATKAAPTRAARDITLQSLE 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 65/276 (24%)
Pkinase 102..349 CDD:278497 65/276 (24%)
CKL13NP_171939.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 72/307 (23%)
Pkinase 9..241 CDD:278497 62/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.