DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and ADK1

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_563695.2 Gene:ADK1 / 839368 AraportID:AT1G03930 Length:471 Species:Arabidopsis thaliana


Alignment Length:282 Identity:66/282 - (23%)
Similarity:111/282 - (39%) Gaps:37/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQ 171
            |:|.|||||::...:...|:..|||:.....:..|...|.    :.|....|............:
plant    14 KIGSGSFGELYLGINVQTGEEVAVKLESVKTKHPQLHYES----KLYMLLQGGTGVPNLKWYGVE 74

  Fly   172 YDRLYMQMELCRESLEQYLLRCQRIPEERIWHILLD-LLRGLKSLHDRNLIHLDIKLDNVL--IG 233
            .|...|.::|...|||.....|.|....:...:|.| |:..::.:|.|..:|.|||.||.|  :|
plant    75 GDYNVMVIDLLGPSLEDLFNYCNRKLSLKTVLMLADQLINRVEFMHTRGFLHRDIKPDNFLMGLG 139

  Fly   234 EDDETCKLADFGLVIDVDRANSHH--------ATEGDSRYMAPEILQG-HFSKAADIFSLGIAML 289
            .......:.||||........:|.        ...|.:||.:.....| ..|:..|:.:||..::
plant   140 RKANQVYIIDFGLGKKYRDLQTHRHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLEALGYVLM 204

  Fly   290 ELACYM---DLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHPKL 351
                |.   .||     |..|:.|...:::......::.:.|:.:.|..|:      :.:|:  .
plant   205 ----YFLKGSLP-----WQGLKAGTKKQKYDRISEKKVATPIEVLCKNQPS------EFVSY--F 252

  Fly   352 QYLQKKR-KSLMNFSMLSRSFR 372
            :|.:..| ....::|.|.|.||
plant   253 RYCRSLRFDDKPDYSYLKRLFR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 59/256 (23%)
Pkinase 102..349 CDD:278497 59/256 (23%)
ADK1NP_563695.2 STKc_CK1_delta_epsilon 8..282 CDD:271027 66/282 (23%)
SPS1 8..>277 CDD:223589 66/282 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.