DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and WNK8

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_568599.1 Gene:WNK8 / 834204 AraportID:AT5G41990 Length:563 Species:Arabidopsis thaliana


Alignment Length:281 Identity:74/281 - (26%)
Similarity:132/281 - (46%) Gaps:22/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQY-----RAERL-EEVRRYEEFSGHENCIRFI 166
            ||.|:|..|::..|..||    ::::..|...|..     :.||| .||...:... |||.|:..
plant    35 LGRGAFKTVYKAFDEVDG----IEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALK-HENIIKLF 94

  Fly   167 RAW--EQYDRLYMQMELCRE-SLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRN--LIHLDIK 226
            .:|  |:...:.|..||... ||..|..:.:::..:.|.:....:|:||..||.:|  :||.|:|
plant    95 YSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYLHSQNPPVIHRDLK 159

  Fly   227 LDNVLIGEDDETCKLADFGLVIDVDRANSHHATEGDSRYMAPEILQGHFSKAADIFSLGIAMLEL 291
            .||:.:..:....|:.|.||...:.:..: .:..|...:||||:.:..:::..||:|.|:.|||:
plant   160 CDNIFVNGNTGEVKIGDLGLATVLQQPTA-RSVIGTPEFMAPELYEEEYNELVDIYSFGMCMLEM 223

  Fly   292 -AC---YMDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHPKLQ 352
             .|   |.:..:...::.::...|.|:........:::..|:..:.| .:.||||.:|...|.|.
plant   224 VTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEKCLLP-ASSRPTALELSKDPFLA 287

  Fly   353 YLQKKRKSLMNFSMLSRSFRR 373
            ....|..:|:..|..|..:.|
plant   288 RDGGKDSALLASSSTSSKYVR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 67/255 (26%)
Pkinase 102..349 CDD:278497 67/255 (26%)
WNK8NP_568599.1 STKc_WNK 27..286 CDD:270885 68/257 (26%)
S_TKc 33..286 CDD:214567 68/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.