DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and SnRK1.3

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_198760.1 Gene:SnRK1.3 / 833940 AraportID:AT5G39440 Length:494 Species:Arabidopsis thaliana


Alignment Length:414 Identity:104/414 - (25%)
Similarity:175/414 - (42%) Gaps:86/414 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 RLAK-LGEGSFGEVFQVRDRSDGQLYAVKI---SKQLFRGEQYRAERLEEVRRYEEFSGHENCIR 164
            |:.| ||.|||.:|......:.|...|:||   ||....|.:.:.:|..::.|   |..|.:.||
plant    20 RIGKTLGHGSFAKVKLALHVATGHKVAIKILNRSKIKNMGIEIKVQREIKILR---FLMHPHIIR 81

  Fly   165 FIRAWEQYDRLYMQMELCRE-SLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLD 228
            .....|..:.:|:.||..:. .|..|::...::.|:...|:...::.|::..|...::|.|:|.:
plant    82 QYEVIETPNDIYVVMEYVKSGELFDYIVEKGKLQEDEARHLFQQIISGVEYCHRNMIVHRDLKPE 146

  Fly   229 NVLIGEDDETC--KLADFGLVIDVDRANSHH------ATEGDSRYMAPEILQGH-FSKAADIFSL 284
            |||:   |..|  |:.||||      :|..|      .:.|...|.|||::.|. :....||:|.
plant   147 NVLL---DSQCNIKIVDFGL------SNVMHDGHFLKTSCGSPNYAAPEVISGKPYGPDVDIWSC 202

  Fly   285 GIAMLELACYMDLP---SNGP-LWHELRHGI--LPEEFINKISLELQSVIKSMMKPDPAQRPTAE 343
            |:.:..|.| ..||   .|.| ::.:::.|:  ||    |.:|...:.:|..|:..||..|.:..
plant   203 GVILYALLC-GTLPFDDENIPNVFEKIKRGMYTLP----NHLSHFARDLIPRMLMVDPTMRISIT 262

  Fly   344 QLLSHPKLQ-----YLQ----------KKRKSLMNFSMLSRSFRRSR--RAVWGRMCNWKTAAFR 391
            ::..||...     ||.          ||.:..:..::::..|.|:.  .::..|:.|..|.|:.
plant   263 EIRQHPWFNNHLPLYLSIPPLDTIDQAKKIEEEIIQNVVNIGFDRNHVVDSLANRIQNEATVAYH 327

  Fly   392 YLLYFLEVLHLCKPITASQPNINIVPSSP-SSKGVPLVPQVEFQLVGST-PIANRDCYASDFLSG 454
            .:|              ...|.|.||:.| .||    ..::...:..|| |:.|...:.....|.
plant   328 LIL--------------DNRNQNSVPNDPFQSK----FKEISDGIFNSTLPVQNITSHVGHSFSA 374

  Fly   455 ---------ED---PLDLSNQGSP 466
                     :|   .|.|.:||||
plant   375 LYGLKSNVKDDKTWTLGLQSQGSP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 72/264 (27%)
Pkinase 102..349 CDD:278497 72/264 (27%)
SnRK1.3NP_198760.1 STKc_AMPK_alpha 16..270 CDD:270981 74/266 (28%)
UBA_SnRK1_plant 292..332 CDD:270520 7/53 (13%)
AMPKA_C 388..491 CDD:213378 6/11 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.