DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and AT5G27510

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_198103.1 Gene:AT5G27510 / 832811 AraportID:AT5G27510 Length:301 Species:Arabidopsis thaliana


Alignment Length:298 Identity:87/298 - (29%)
Similarity:137/298 - (45%) Gaps:61/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LGEG--SFGEVFQVRDRSDGQLY--AVKISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRA 168
            ||||  ||.::|:. .:|||..:  |||.|..       ....|:|.....|..|   |.|.|:.
plant    11 LGEGAYSFVDLFKY-TKSDGSSFHAAVKSSDD-------ENSLLKEFHILSELKG---CPRIIQC 64

  Fly   169 W-----EQYD----RLY-MQMELCRE-SLEQYLLRC--QRIPEERIWHILLDLLRGLKSLHDRNL 220
            :     |.:|    |:| :.:|...| ||..::..|  :::|:..|......:|:||.|:|....
plant    65 FGNDLEEGFDDKGNRVYKLLLEYASEGSLSDFMNNCVDRKLPDLMIRDFTRMILQGLVSIHSHGY 129

  Fly   221 IHLDIKLDNVLI---GEDDETCKLADFGLVIDVDRANSHHATE----GDSRYMAPEIL-QGHFSK 277
            :|.|:|.:|||:   |:..|. |::||||.:.|.....|...|    |...||.||.| .|..:|
plant   130 VHCDLKPENVLVFPCGDSYEV-KISDFGLSLQVGEVPDHWKIEYPFVGTLNYMPPESLHDGVANK 193

  Fly   278 AADIFSLGIAMLEL-ACYMDLPSNGPLWHELRHGILPEEFI------------NKISLELQSVIK 329
            ..|::|||..:||: .|...       |    .|.:||:|:            ..:..:.::.|:
plant   194 TLDLWSLGCLVLEMYVCKKP-------W----IGFIPEDFVYILSNGNPPEIPESLPCDARAFIQ 247

  Fly   330 SMMKPDPAQRPTAEQLLSHPKLQYLQKKRKSLMNFSML 367
            .....:|.:|.||.:||||..|:..:.|.|.:..|::|
plant   248 KCFSRNPKERGTASELLSHRFLRQEKSKLKMISPFNLL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 81/278 (29%)
Pkinase 102..349 CDD:278497 81/278 (29%)
AT5G27510NP_198103.1 PKc_like 9..269 CDD:419665 82/280 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.