DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and AT3G10540

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_187665.2 Gene:AT3G10540 / 820219 AraportID:AT3G10540 Length:486 Species:Arabidopsis thaliana


Alignment Length:323 Identity:81/323 - (25%)
Similarity:141/323 - (43%) Gaps:56/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GSCSTNSSQIAHAISFRDAGCSDSSTLPSSPVQAELSTLSLSHFEQCFERLAKL-GEGSFGEVFQ 118
            |:.|:|...|:.:.||              ..:|.....:...||     |.|: |.||:.:|.:
plant    16 GNSSSNGETISRSKSF--------------AFKAPQENFTYHDFE-----LGKIYGVGSYSKVVR 61

  Fly   119 VRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCR 183
            .:.:.:|.:||:||..:.|..::.:...::..|...:...|...::....::....|||.:|.|.
plant    62 AKKKDNGTVYALKIMDKKFITKENKTAYVKLERIVLDQLEHPGIVKLFFTFQDTQSLYMALESCE 126

  Fly   184 --ESLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGL 246
              |..:| :.|..|:.|:.......:::..|:.:|:..|||.|||.:|:|:..|.. .|:||||.
plant   127 GGELFDQ-ITRKGRLSEDEARFYSAEVVDALEYIHNMGLIHRDIKPENLLLTLDGH-IKIADFGS 189

  Fly   247 V-------IDV--DRANSHHATE--GDSRYMAPEILQGHFSKAA---DIFSLGIAMLELACYMDL 297
            |       |.|  :.|:...|..  |.:.|:.||:|..  |.|.   |:::||..:     |..|
plant   190 VKPMQDSQITVLPNAASDDKACTFVGTAAYVPPEVLNS--SPATFGNDLWALGCTL-----YQML 247

  Fly   298 PSNGPL-----WHELRHGILPE-EFINKISLELQSVIKSMMKPDPAQRPTA-----EQLLSHP 349
            ....|.     |...:..|..: :|.|..|...:.:|..::..||::||.|     :.|..||
plant   248 SGTSPFKDASEWLIFQRIIARDIKFPNHFSEAARDLIDRLLDTDPSRRPGAGSEGYDSLKRHP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 70/276 (25%)
Pkinase 102..349 CDD:278497 70/274 (26%)
AT3G10540NP_187665.2 STKc_PDK1 43..312 CDD:270733 74/282 (26%)
S_TKc 45..312 CDD:214567 74/280 (26%)
PH_3 383..486 CDD:291269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.