DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and NP3

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_187254.1 Gene:NP3 / 819774 AraportID:AT3G06030 Length:651 Species:Arabidopsis thaliana


Alignment Length:280 Identity:83/280 - (29%)
Similarity:135/280 - (48%) Gaps:46/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LGEGSFGEVFQVRDRSDGQLYAVK--------ISKQLFRGEQYRAERLEEVRRYEEFSGHENCIR 164
            :|.|:||.|:...:...|:|.|:|        .||:..:|.....|  |||:..:..| |.|.:|
plant    74 IGCGAFGRVYMGMNLDSGELLAIKQVLIAPSSASKEKTQGHIRELE--EEVQLLKNLS-HPNIVR 135

  Fly   165 FIRAWEQYDRLYMQMELC-RESLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLD 228
            ::....:.|.|.:.||.. ..|:...|.:....||..|......||.||:.||:..::|.|||..
plant   136 YLGTVRESDSLNILMEFVPGGSISSLLEKFGSFPEPVIIMYTKQLLLGLEYLHNNGIMHRDIKGA 200

  Fly   229 NVLIGEDDETC-KLADFGL---VIDVDRANSHHATEGDSRYMAPE-ILQGHFSKAADIFSLGIAM 288
            |:|:  |::.| :|||||.   |:::...|...:.:|...:|||| |||...|.:|||:|:|..:
plant   201 NILV--DNKGCIRLADFGASKKVVELATVNGAKSMKGTPYWMAPEVILQTGHSFSADIWSVGCTV 263

  Fly   289 LELACYMDLPSNGPLWHE--------------LRHGILPEEFINKISLELQSVIKSMMKPDPAQR 339
            :|:|      :..|.|.|              ..|..:||:    :|.|.:..:...:..:|:.|
plant   264 IEMA------TGKPPWSEQYQQFAAVLHIGRTKAHPPIPED----LSPEAKDFLMKCLHKEPSLR 318

  Fly   340 PTAEQLLSHPKLQYLQKKRK 359
            .:|.:||.||   ::..||:
plant   319 LSATELLQHP---FVTGKRQ 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 79/268 (29%)
Pkinase 102..349 CDD:278497 79/268 (29%)
NP3NP_187254.1 STKc_MAPKKK 67..330 CDD:270783 81/273 (30%)
S_TKc 68..330 CDD:214567 81/273 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.