DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and WEE1

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_003381.1 Gene:WEE1 / 7465 HGNCID:12761 Length:646 Species:Homo sapiens


Alignment Length:378 Identity:113/378 - (29%)
Similarity:170/378 - (44%) Gaps:48/378 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NSNRFRPPKYKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAISFRDAGCSD----SSTLPSSPV 86
            |.|.|.|           |:..|:.|   |.|........:.....|...||    ..|.|:..:
Human   234 NINPFTP-----------DSLLLHSS---GQCRRRKRTYWNDSCGEDMEASDYELEDETRPAKRI 284

  Fly    87 QAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEVR 151
            ....|.:. |.:...|..|.|:|.|.||.||:...|.||.:||:|.||:...|.......|.||.
Human   285 TITESNMK-SRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVY 348

  Fly   152 RYEEFSGHENCIRFIRAWEQYDRLYMQMELCR-ESLEQYLLRCQRI----PEERIWHILLDLLRG 211
            .:.....|.:.:|:..||.:.|.:.:|.|.|. .||...:....||    .|..:..:||.:.||
Human   349 AHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRG 413

  Fly   212 LKSLHDRNLIHLDIKLDNVLI------------GEDDETC------KLADFGLVIDVDRANSHHA 258
            |:.:|..:|:|:|||..|:.|            |::|:..      |:.|.|   .|.|.:|...
Human   414 LRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLG---HVTRISSPQV 475

  Fly   259 TEGDSRYMAPEILQGHFS--KAADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEFINKIS 321
            .|||||::|.|:||.:::  ..||||:|.:.::..|....||.||..|||:|.|.|| .....:|
Human   476 EEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLP-RIPQVLS 539

  Fly   322 LELQSVIKSMMKPDPAQRPTAEQLLSHPKLQYLQKKRKSLMNFSMLSRSFRRS 374
            .|...::|.|:.|||.:||:|..|:.|..|....:|....:...:.:..|:.|
Human   540 QEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNS 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 92/273 (34%)
Pkinase 102..349 CDD:278497 92/271 (34%)
WEE1NP_003381.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..181
PTKc_Wee1a 293..568 CDD:271040 94/278 (34%)
Pkinase 299..569 CDD:278497 93/273 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063695at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.