DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Ulk3

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001258064.1 Gene:Ulk3 / 691171 RGDID:1587417 Length:472 Species:Rattus norvegicus


Alignment Length:263 Identity:61/263 - (23%)
Similarity:119/263 - (45%) Gaps:33/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KLGEGSFGEVFQV-RDRSDGQLYAVK-----------ISKQLFRGEQYRAERLEEVRRYEEFSGH 159
            :||.|::..|::. ..::..::.|:|           :...|...|..:..|...:.:.::|.  
  Rat    19 RLGSGTYATVYKAYAKKATREVVAIKCVAKKSLNKASVENLLTEIEILKGIRHPHIVQLKDFQ-- 81

  Fly   160 ENCIRFIRAWEQYDRLYMQMELCRESLEQYLLRCQRIPEERIWHILL-DLLRGLKSLHDRNLIHL 223
                     |:. |.:|:.||.|........:..:||..|::..:.: .|...|:.||:||:.||
  Rat    82 ---------WDN-DNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHL 136

  Fly   224 DIKLDNVLIGE-DDETCKLADFGLVIDVDRANSHHATEGDSRYMAPE-ILQGHFSKAADIFSLGI 286
            |:|..|:|:.. :....||||||....:...:..|...|...||||| :.:..:....|::|:|:
  Rat   137 DLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCRRQYDARVDLWSVGV 201

  Fly   287 AMLELACYMDLPSNGPLWHELRHGILPEEFIN-----KISLELQSVIKSMMKPDPAQRPTAEQLL 346
            .:.| |.:...|.....:.||...|.....|.     ::||:.:.:::.:::.||:.|.:.:...
  Rat   202 ILYE-ALFGQPPFASRSFSELEEKIRSNRVIELPLRPQLSLDCRDLLQRLLERDPSHRISFQDFF 265

  Fly   347 SHP 349
            :||
  Rat   266 AHP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 59/261 (23%)
Pkinase 102..349 CDD:278497 59/261 (23%)
Ulk3NP_001258064.1 S_TKc 14..270 CDD:214567 61/263 (23%)
STKc_ULK3 18..269 CDD:271023 61/263 (23%)
MIT_2 279..353 CDD:239147
MIT 374..449 CDD:294211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.