DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and STK3

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_016869245.1 Gene:STK3 / 6788 HGNCID:11406 Length:580 Species:Homo sapiens


Alignment Length:281 Identity:86/281 - (30%)
Similarity:133/281 - (47%) Gaps:58/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 EQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAER-LEEVRRYEEFSGHENC 162
            |:.|:.|.||||||:|.||:...:..||:.|:|         |...|. |:|:  .:|.|..:.|
Human   109 EEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIK---------QVPVESDLQEI--IKEISIMQQC 162

  Fly   163 -----IRFIRAWEQYDRLYMQMELC-RESLEQYL-LRCQRIPEERIWHILLDLLRGLKSLHDRNL 220
                 :::..::.:...|::.||.| ..|:...: ||.:.:.|:.|..||...|:||:.||....
Human   163 DSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRK 227

  Fly   221 IHLDIKLDNVLIGEDDETCKLADFGLVIDV-DRANSHHATEGDSRYMAPEILQG-HFSKAADIFS 283
            ||.|||..|:|:..:.. .||||||:...: |.....:...|...:||||::|. .::..|||:|
Human   228 IHRDIKAGNILLNTEGH-AKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWS 291

  Fly   284 LGIAMLELA----CYMD---------LPSNGP-------LWHELRHGILPEEFINKISLELQSVI 328
            |||..:|:|    .|.|         :|:|.|       ||.:                :....:
Human   292 LGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSD----------------DFTDFV 340

  Fly   329 KSMMKPDPAQRPTAEQLLSHP 349
            |..:..:|.||.||.|||.||
Human   341 KKCLVKNPEQRATATQLLQHP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 83/278 (30%)
Pkinase 102..349 CDD:278497 83/276 (30%)
STK3XP_016869245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.