DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Stk4

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_067395.1 Gene:Stk4 / 58231 MGIID:1929004 Length:487 Species:Mus musculus


Alignment Length:303 Identity:91/303 - (30%)
Similarity:139/303 - (45%) Gaps:71/303 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DSSTLPSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQ 141
            |..:|...|             |:.|:.|.||||||:|.|::...:..||:.|:|         |
Mouse    18 DEDSLTKQP-------------EEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIK---------Q 60

  Fly   142 YRAER-LEEVRRYEEFSGHENC-----IRFIRAWEQYDRLYMQMELC-RESLEQYL-LRCQRIPE 198
            ...|. |:|:  .:|.|..:.|     :::..::.:...|::.||.| ..|:...: ||.:.:.|
Mouse    61 VPVESDLQEI--IKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTE 123

  Fly   199 ERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGLVIDV-DRANSHHATEGD 262
            :.|..||...|:||:.||....||.|||..|:|:..:.. .||||||:...: |.....:...|.
Mouse   124 DEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGH-AKLADFGVAGQLTDTMAKRNTVIGT 187

  Fly   263 SRYMAPEILQG-HFSKAADIFSLGIAMLELA----CYMD---------LPSNGP-------LWHE 306
            ..:||||::|. .::..|||:||||..:|:|    .|.|         :|:|.|       ||.:
Mouse   188 PFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSD 252

  Fly   307 LRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHP 349
                       |.:....|.::||     |.||.||.|||.||
Mouse   253 -----------NFMDFVKQCLVKS-----PEQRATATQLLQHP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 85/278 (31%)
Pkinase 102..349 CDD:278497 85/276 (31%)
Stk4NP_067395.1 STKc_MST1_2 26..281 CDD:132943 89/295 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..334
Mst1_SARAH 433..480 CDD:314497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.