DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and camk1a

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_021332939.1 Gene:camk1a / 555945 ZFINID:ZDB-GENE-131120-147 Length:394 Species:Danio rerio


Alignment Length:333 Identity:90/333 - (27%)
Similarity:143/333 - (42%) Gaps:63/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LGEGSFGEVFQVRDRSDGQLYAVK-ISKQLFRGEQYRAER----LEEVRRYEEFSGHENCIRFIR 167
            ||.|:|.|||...::...:|.|:| |.|:...|::...|.    |..::       |||.:....
Zfish    27 LGTGAFSEVFLAEEKKTQRLVAIKCIPKKALEGKENSIENEIAVLHRIK-------HENIVSLED 84

  Fly   168 AWEQYDRLYMQMELCRESLEQYLLRCQRIPEERIW------HILLDLLRGLKSLHDRNLIHLDIK 226
            .:|....||:.|:|.... |.:    .||.|:..:      .::..:|..:|.|||..::|.|:|
Zfish    85 IFESQSHLYLVMQLVSGG-ELF----DRIVEKGFYTERDASKLIRQILDAVKYLHDMGIVHRDLK 144

  Fly   227 LDNVLI--GEDDETCKLADFGLVIDVDRANSHHATEGDSRYMAPEIL-QGHFSKAADIFSLGIAM 288
            .:|:|.  .|:|....::||||....|..:......|...|:|||:| |..:|||.|.:|:|:..
Zfish   145 PENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIS 209

  Fly   289 LELACYMDLPSNGPLWHE----LRHGILPEE------FINKISLELQSVIKSMMKPDPAQRPTAE 343
            ..|.|     ...|.:.|    |...||..|      :.:.||...:..|..:|:.||:.|.|.|
Zfish   210 YILLC-----GYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTCE 269

  Fly   344 QLLSHP--------------------KLQYLQKKRKSLMNFSMLSRSFRRSR--RAVWGRMCNWK 386
            |.|.||                    |..:.:.|.|...|.:.:.|..||.:  .::.|......
Zfish   270 QALLHPWISGDTALDKNIHESVSAQIKKNFAKSKWKQAFNATAVVRHMRRLQLSTSLEGPSQITS 334

  Fly   387 TAAFRYLL 394
            |:.:|:||
Zfish   335 TSPYRHLL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 76/264 (29%)
Pkinase 102..349 CDD:278497 76/264 (29%)
camk1aXP_021332939.1 STKc_CaMKI 17..276 CDD:270985 77/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.