DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and ern1

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001018366.1 Gene:ern1 / 553551 ZFINID:ZDB-GENE-050522-431 Length:292 Species:Danio rerio


Alignment Length:155 Identity:30/155 - (19%)
Similarity:51/155 - (32%) Gaps:54/155 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 SRRAVW-----------GRM--CNWKTAAFRYLLYFLEVL------------------------- 400
            ||..||           |.|  |:..|.:....|.|:..|                         
Zfish     7 SRALVWIITALIWWSHSGLMGFCSSSTVSVPESLLFVSTLDGNLHAVSKISGTIKWTLKEDPVLQ 71

  Fly   401 ---HLCKPITASQPNINIVPS--SPSSKGVPLVPQVEFQLVGSTPIANRD-----------CYAS 449
               |:.:|.....||...:.|  ..:::|:..:|....:||.::|..:.|           .|..
Zfish    72 VPTHVSEPAFLPDPNDGSLYSLGGKNNEGLTKLPFTIPELVQASPCRSSDGILYMGKKQDVRYVV 136

  Fly   450 DFLSGEDPLDLSNQGSPNVINSTPL 474
            |.|:||....|::..:..:..|:.|
Zfish   137 DLLTGEKKQTLTSSYAEMLCPSSSL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952
Pkinase 102..349 CDD:278497
ern1NP_001018366.1 PQQ_2 16..228 CDD:290097 26/146 (18%)
Luminal_IRE1 38..265 CDD:188875 22/124 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.