DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and cdkl1

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001003773.1 Gene:cdkl1 / 445316 ZFINID:ZDB-GENE-040808-34 Length:350 Species:Danio rerio


Alignment Length:329 Identity:87/329 - (26%)
Similarity:146/329 - (44%) Gaps:80/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FERLAKLGEGSFGEVFQVRDRSDGQLYAVK---------ISKQLFRGEQYRAERLEEVRRYEEFS 157
            :|:::|:||||:|.||:.|::..||:.|:|         |.|::         .|.|:|..::..
Zfish     4 YEKISKIGEGSYGVVFKCRNKDTGQIVAIKKFVESEDDPIIKKI---------ALREIRMLKQLK 59

  Fly   158 GHENCIRFIRAWEQYDRLYMQMELCRESLEQYLLRCQR-IPEERIWHILLDLLRGLKSLHDRNLI 221
             |.|.:..:..:.:..:|::..|.|..::...|.|..| :||..:..|:...|:.:...|.:|.|
Zfish    60 -HPNLVNLMEVFRRKRKLHLVFEYCDHTVLNELDRYPRGVPEHMVKSIIWQTLQAVNFCHKQNCI 123

  Fly   222 HLDIKLDNVLIGEDDETCKLADFG----LVIDVDRANSHHATEGDSRYMAPEILQG--HFSKAAD 280
            |.|:|.:|:||.: .:..||.|||    |....|......||..   |.|||:|.|  .:....|
Zfish   124 HRDVKPENILITK-HQVIKLCDFGFARILTGPCDYYTDCVATRW---YRAPELLVGDTQYGPPVD 184

  Fly   281 IFSLGIAMLELACYMDLPSNGPLW----------------HEL--RH-----------GIL---P 313
            ::::|....||.      |..|||                .||  ||           |:.   |
Zfish   185 VWAVGCVFAELL------SGAPLWPGKSDVDQLYLIRKTLGELIPRHQQVFSTNQFFSGVCVPEP 243

  Fly   314 EEF------INKISLELQSVIKSMMKPDPAQRPTAEQLLSHPKLQYLQKKRKSLMNFSMLSRSFR 372
            :|.      ...:|.:..|::|..::.|||:|.:.||||..|....|:::.:|      ::|...
Zfish   244 QEMEPLELKYPNLSYQALSLMKGCLRMDPAERLSCEQLLEQPYFDSLREESES------VTRELD 302

  Fly   373 RSRR 376
            |.:|
Zfish   303 RKKR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 81/300 (27%)
Pkinase 102..349 CDD:278497 81/300 (27%)
cdkl1NP_001003773.1 STKc_CDKL1_4 2..287 CDD:270837 82/302 (27%)
Pkinase 4..287 CDD:278497 82/302 (27%)
[NKR]KIAxRE 45..51 2/14 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..318 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.