DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and KP78a

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_650066.1 Gene:KP78a / 41362 FlyBaseID:FBgn0026064 Length:705 Species:Drosophila melanogaster


Alignment Length:482 Identity:110/482 - (22%)
Similarity:195/482 - (40%) Gaps:82/482 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SDSSTLPSSPVQAELSTL---------SLSHFEQ--------CFERLAKLGEGSFGEVFQVRDRS 123
            |:::.||::|..|....|         :.|.|:.        .::.:..||:|:|.:|.......
  Fly    55 SNATALPATPTVAAGQDLGDGACSSKNTDSKFQSYVNGNGNGVYKIIKTLGKGNFAKVKLAIHVP 119

  Fly   124 DGQLYAVKISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELC-RESLE 187
            .|:..|:|:..:.......|.:...|| :..:...|.|.:|..:..|....||:.||.. |..|.
  Fly   120 TGREVAIKVIDKTQLNTSARQKLYREV-KIMKLLNHPNIVRLFQVIESERTLYLVMEYASRGELF 183

  Fly   188 QYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGLVIDVDR 252
            .:|::..|:.|.....|...|:..::..|.:.::|.|:|.:|:|: :.....|:||||.....|.
  Fly   184 DHLVKNGRMRERDARVIFRQLVSAIQYCHSKFVVHRDLKAENLLL-DQHMNIKIADFGFGNTFDP 247

  Fly   253 ANSHHATEGDSRYMAPEILQG--HFSKAADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPEE 315
            ........|...|.|||:..|  :.....|.:|||:.:..|.. ..||.:|....|||..:|..:
  Fly   248 NAQLETFCGSPPYAAPELFMGRKYAGPEVDAWSLGVVLYTLVS-GSLPFDGGTLKELRERVLRGK 311

  Fly   316 F--INKISLELQSVIKSMMKPDPAQRPTAEQLLS-------HPKLQYLQKKRKSLMNFSMLSR-- 369
            :  ...||::.:::::..:..:||:|.:...::|       |.:...|:..|:..|.....:|  
  Fly   312 YRVPYYISMDCENLMRKFLVLNPAKRTSLSAVMSDKWINLGHDESDRLRPFREKPMELQDAARFD 376

  Fly   370 ---SFRRSRR----AVWGRMCNWKTAAFRYLLYFLEVLHLCKPITASQ-------PNINIVPSSP 420
               |....||    :|.|::.:     ..|..|.|  |.:.||.::::       |.:::...:.
  Fly   377 LLMSMGHKRRDVEQSVKGQLFD-----DIYCTYML--LGVAKPRSSNRSTKPEAIPTVDLTTPAV 434

  Fly   421 SSKGVPL---------VPQVEFQLVGSTPIANRDCYASDFLSGEDPLDLSNQGSPNVINSTPLN- 475
            ||   ||         :..|...|..:.||      .|...||. |:......:||...|||.. 
  Fly   435 SS---PLPNITTPTVTIAHVTLALDKNPPI------HSSSASGR-PIAPRLANAPNTPTSTPPTG 489

  Fly   476 -----TNQGKSRLDLLK--NNVDSMGR 495
                 |.:..:|....|  |:....||
  Fly   490 PPAKPTRRTPARTPARKATNHTSGQGR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 62/268 (23%)
Pkinase 102..349 CDD:278497 62/258 (24%)
KP78aNP_650066.1 PKc_like 98..349 CDD:304357 62/253 (25%)
S_TKc 98..349 CDD:214567 62/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.