DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Strn-Mlck

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster


Alignment Length:587 Identity:129/587 - (21%)
Similarity:215/587 - (36%) Gaps:155/587 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KQCNGENSNRFRPPKYKTRGYVAVDNNNLNRSQSLGSCS-----TNSSQIAHAISFRDAGCSDSS 79
            |....|...|||           |...|::...:.|..|     ||:.|           .|.||
  Fly  7555 KNLQPERQYRFR-----------VRAENIHGRSAPGQASELVQITNTPQ-----------RSTSS 7597

  Fly    80 TLPSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSD-GQLYAVKISKQLFRGEQYR 143
            .......||.:|..|...|:..||.:.:||:|.||.|::|::|.. .||.|.|:.|.:  ..|.|
  Fly  7598 DASDRFGQATVSVQSGGDFKSRFEIIEELGKGRFGIVYKVQERGQPEQLLAAKVIKCI--KSQDR 7660

  Fly   144 AERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCR--ESLEQYLLRCQRIPEERIWHILL 206
            .:.|||:....... |...::...::|....:.|.||...  |..|:.:.....:.|......|.
  Fly  7661 QKVLEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILFLR 7724

  Fly   207 DLLRGLKSLHDRNLIHLDIKLDNVLI-GEDDETCKLADFGLVIDVDRANSHHATEGDSRYMAPEI 270
            .:..|:..:|.::::|||:|.:|::. .......|:.||||...:|.........|...::.|||
  Fly  7725 QVCDGVAYMHGQSVVHLDLKPENIMCHTRTSHQIKIIDFGLAQRLDTKAPVRVLFGTPEFIPPEI 7789

  Fly   271 LQGH-FSKAADIFSLGIAMLELACYMDLPSNGPLWHELRHGILP--------------------- 313
            :... ....:|::|:|:     .||:           |..|:.|                     
  Fly  7790 ISYEPIGFQSDMWSVGV-----ICYV-----------LLSGLSPFMGDTDVETFSNITRADYDYD 7838

  Fly   314 EEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHPKLQYLQKKRKSLMNFS---------MLSR 369
            :|..:.:|.|.:..|..::......|.||:|.|:...|.  |:...||.|..         ::.|
  Fly  7839 DEAFDCVSQEAKDFISQLLVHRKEDRLTAQQCLASKWLS--QRPDDSLSNNKICTDKLKKFIIRR 7901

  Fly   370 SFRRSRRAV--WGRMCNWKTAAFRYLLYFLEVLHLCKPITASQPNINI---VPSS--PSSKGVPL 427
            .::::..|:  .|||.|                     ::.|:.|..|   |.||  ||..|:.:
  Fly  7902 KWQKTGNAIRALGRMAN---------------------LSVSRRNSAIAMGVLSSPRPSISGLGM 7945

  Fly   428 VPQVEFQLVGS------TPIANRDCYASDFLSGEDP----------------LDLSNQGSPNVIN 470
            :..   ..:||      |.:...:    |..|||.|                .:.|:.|.....|
  Fly  7946 LTT---SAIGSGTSSQMTSLHEEE----DDFSGEMPPVEKRTVLKLRDKSQCSERSDSGYSECSN 8003

  Fly   471 STPLNTNQGKSRLDLLKNNVDSMGRY----VHVHDFESPCS--------ALSSAKVLDTSSFRRK 523
            .:..   |....|.|.|:.::::.:.    ..|||.|.|.|        |:..:...:|...|:|
  Fly  8004 CSGA---QETLLLSLAKSKLEAIAKASTLPTVVHDTEQPVSLELPTKGEAIMRSDFTNTIKMRKK 8065

  Fly   524 KL 525
            .|
  Fly  8066 SL 8067

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 63/274 (23%)
Pkinase 102..349 CDD:278497 63/272 (23%)
Strn-MlckNP_001261019.1 IG_like 51..127 CDD:214653
Ig <69..>112 CDD:299845
I-set 137..226 CDD:254352
I-set 235..314 CDD:254352
Ig_2 244..314 CDD:290606
I-set 438..513 CDD:254352
Ig 454..510 CDD:143165
I-set 537..626 CDD:254352
Ig 555..618 CDD:299845
I-set 636..713 CDD:254352
Ig 652..712 CDD:143165
SMC_N <2190..2854 CDD:280601
I-set 5300..5388 CDD:254352
IGc2 5313..5378 CDD:197706
IG 5412..5482 CDD:214652
IGc2 5413..5481 CDD:197706
I-set 5542..5627 CDD:254352
Ig 5556..5621 CDD:143165
Ig 5654..5721 CDD:143165
I-set 5784..5874 CDD:254352
IGc2 5797..5864 CDD:197706
I-set 5887..5970 CDD:254352
Ig 5902..5966 CDD:143165
I-set 5997..6086 CDD:254352
Ig 6026..6083 CDD:143165
I-set 6097..6187 CDD:254352
Ig 6114..6187 CDD:299845
FN3 6216..6310 CDD:238020
I-set 6321..6412 CDD:254352
Ig 6328..6412 CDD:299845
I-set 6442..6531 CDD:254352
Ig 6459..6528 CDD:143165
I-set 6541..6632 CDD:254352
IGc2 6555..6622 CDD:197706
I-set 6662..6754 CDD:254352
Ig 6679..6751 CDD:143165
I-set 6779..6868 CDD:254352
IGc2 6793..6858 CDD:197706
Ig 6938..7022 CDD:299845
I-set 6939..7028 CDD:254352
IG 7075..7140 CDD:214652
Ig 7075..7140 CDD:143165
IG 7167..7239 CDD:214652
Ig 7173..7239 CDD:143165
Ig 7392..7475 CDD:299845
IG 7406..7475 CDD:214652
FN3 7489..7588 CDD:238020 9/43 (21%)
S_TKc 7620..7876 CDD:214567 63/274 (23%)
STKc_MLCK 7626..7876 CDD:271005 61/268 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.