DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Ern2

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001102389.1 Gene:Ern2 / 365363 RGDID:1308743 Length:927 Species:Rattus norvegicus


Alignment Length:314 Identity:87/314 - (27%)
Similarity:141/314 - (44%) Gaps:59/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PSSPVQ------AELSTL--SLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVK-ISKQLF 137
            |..|||      ||..|:  .:|     |.....||.|: |..|..|.:.:|:..||| :.::.|
  Rat   487 PPEPVQPAHDPEAEQPTVVGKIS-----FNPKDVLGRGA-GGTFVFRGQFEGRAVAVKRLLRECF 545

  Fly   138 RGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCRESLEQYLLRCQRIPEERIW 202
            ...|      .||:..:|...|.|.:|:....:.....|:.:|||:.||::|:    ..|:...|
  Rat   546 SLVQ------REVQLLQESDRHPNVLRYFCTEQGPQFHYIALELCQASLQEYV----ESPDLDRW 600

  Fly   203 -----HILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCK----LADFGLV--IDVDRA--N 254
                 .:|..::.||..||..:::|.|:|..|:|:...|...:    ::||||.  :...|.  :
  Rat   601 GLGPTMVLQQMMSGLAHLHSLHIVHRDLKPGNILMAGPDSQGQGRVVISDFGLCKKLPAGRCSFS 665

  Fly   255 SHHATEGDSRYMAPEILQ---GHFSKAADIFSLGIAMLELACYMDLPSNGPLWHELR-----HGI 311
            .|....|...:||||:||   ...:.|.||||.|.....:......|....|:.:..     |.:
  Rat   666 LHSGIPGTEGWMAPELLQLPPDSPTSAVDIFSAGCVFYYVLSGGSHPFGESLYRQANILSGDHCL 730

  Fly   312 --LPEEFINK-ISLELQSVIKSMMKPDPAQRPTAEQLLSHP-------KLQYLQ 355
              |.||..:| ::|:|   :|:|:...|..||:|..:|:||       :||:.|
  Rat   731 AQLQEETHDKVVALDL---VKAMLSLLPQDRPSAGWVLAHPLFWSRAKELQFFQ 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 74/273 (27%)
Pkinase 102..349 CDD:278497 74/271 (27%)
Ern2NP_001102389.1 Luminal_IRE1 37..365 CDD:188875
PQQ <40..236 CDD:224437
STKc_IRE1 507..771 CDD:270884 77/282 (27%)
S_TKc 510..770 CDD:214567 76/273 (28%)
RNase_Ire1 774..899 CDD:199217 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.