DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Nek6

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001264161.1 Gene:Nek6 / 360161 RGDID:727779 Length:313 Species:Rattus norvegicus


Alignment Length:279 Identity:74/279 - (26%)
Similarity:130/279 - (46%) Gaps:24/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFR--GEQYRA 144
            |..| |...:|||.......|:...|:|.|.|.||::.....|.:..|:| ..|:|.  ..:.|.
  Rat    26 PPDP-QRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALK-KVQIFEMMDAKARQ 88

  Fly   145 ERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELC----RESLEQYLLRCQR-IPEERIWHI 204
            :.::|:...::.: |.|.|:::.::.:.:.|.:.:||.    ...:.:|..:.:| |||..:|..
  Rat    89 DCVKEIGLLKQLN-HPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKY 152

  Fly   205 LLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGL-VIDVDRANSHHATEGDSRYMAP 268
            .:.|...::.:|.|.::|.|||..||.|.... ..||.|.|| ........:.|:..|...||:|
  Rat   153 FVQLCSAVEHMHSRRVMHRDIKPANVFITATG-IVKLGDLGLGRFFSSETTAAHSLVGTPYYMSP 216

  Fly   269 E-ILQGHFSKAADIFSLGIAMLELACY--------MDLPSNGPLWHELRHGILPEEFINKISLEL 324
            | |.:..::..:||:|||..:.|:|..        |:|.|......:..:..||.|..::   :|
  Rat   217 ERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSE---KL 278

  Fly   325 QSVIKSMMKPDPAQRPTAE 343
            :.::...:.|||..||..|
  Rat   279 RELVSMCIYPDPNHRPDIE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 68/261 (26%)
Pkinase 102..349 CDD:278497 68/259 (26%)
Nek6NP_001264161.1 Interaction with ARHGAP33, ANKRA2, CDC42, PRDX3, RAD26L, RBBP6, RPS7 and TRIP4. /evidence=ECO:0000250 1..44 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 2/5 (40%)
STKc_Nek6_7 44..305 CDD:270863 68/260 (26%)
Interaction with APBB1. /evidence=ECO:0000250 267..270 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.