DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Y60A9A.1

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001361883.1 Gene:Y60A9A.1 / 3565457 WormBaseID:WBGene00013371 Length:104 Species:Caenorhabditis elegans


Alignment Length:107 Identity:23/107 - (21%)
Similarity:41/107 - (38%) Gaps:28/107 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 PLVPQVEFQLVGSTPIANRDCYASDFLSGEDPLDLS-NQGSPN-----VINSTPLNTNQGKSRLD 484
            |...||..:.:  |.:|.|.  .|..:|   |.|.| ::..||     :.::.|...|       
 Worm    18 PETSQVHLESL--TGVAVRQ--TSKIVS---PFDFSDSENLPNAQRRLITDTVPCCLN------- 68

  Fly   485 LLKNNVDSMGRYVHVHDFESPCSALSSAKVLDTSSFRRKKLF 526
             ..|:.|.       .:.::.||:..|:.:.....|::.|.|
 Worm    69 -FDNDQDD-------DEEQATCSSTKSSPIEPQIIFKKDKCF 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952
Pkinase 102..349 CDD:278497
Y60A9A.1NP_001361883.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003337
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.