DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and NEK5

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001352481.1 Gene:NEK5 / 341676 HGNCID:7748 Length:832 Species:Homo sapiens


Alignment Length:269 Identity:76/269 - (28%)
Similarity:131/269 - (48%) Gaps:20/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FERLAKLGEGSFGEVFQVRDRSDGQLYAVK-ISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRF 165
            ::.:..:|:|:||:.:..:.:||.:...:| |:.:....::..|.: :||...|:.. |.|.:.|
Human     4 YDVIKAIGQGAFGKAYLAKGKSDSKHCVIKEINFEKMPIQEKEASK-KEVILLEKMK-HPNIVAF 66

  Fly   166 IRAWEQYDRLYMQMELCRESLEQYLLRCQR---IPEERI--WHILLDLLRGLKSLHDRNLIHLDI 225
            ..::::..||::.||.|........:..||   ..|::|  |.:.:.|  |||.:|||.::|.||
Human    67 FNSFQENGRLFIVMEYCDGGDLMKRINRQRGVLFSEDQILGWFVQISL--GLKHIHDRKILHRDI 129

  Fly   226 KLDNVLIGEDDETCKLADFGLVIDVDRANSHHATE---GDSRYMAPEILQGH-FSKAADIFSLGI 286
            |..|:.:.::....||.|||:...::  ||.....   |...|::|||.|.. ::...||:|||.
Human   130 KAQNIFLSKNGMVAKLGDFGIARVLN--NSMELARTCIGTPYYLSPEICQNKPYNNKTDIWSLGC 192

  Fly   287 AMLELACYMDLPSNGPLWHELRHGILPEEFI---NKISLELQSVIKSMMKPDPAQRPTAEQLLSH 348
            .:.|| |.:..|..|....:|...|....|.   ...|.||.|:|..:.:..|..||:...:|..
Human   193 VLYEL-CTLKHPFEGNNLQQLVLKICQAHFAPISPGFSRELHSLISQLFQVSPRDRPSINSILKR 256

  Fly   349 PKLQYLQKK 357
            |.|:.|..|
Human   257 PFLENLIPK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 72/259 (28%)
Pkinase 102..349 CDD:278497 72/259 (28%)
NEK5NP_001352481.1 STKc_Nek5 3..259 CDD:173765 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.