DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and vito

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_729096.1 Gene:vito / 326214 FlyBaseID:FBgn0052418 Length:264 Species:Drosophila melanogaster


Alignment Length:98 Identity:28/98 - (28%)
Similarity:42/98 - (42%) Gaps:29/98 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SDSSTLPSSPVQAEL------STLSLSHFEQCF---ERLAKLGEGSFGEVFQVRDRSDGQLYAVK 131
            |::||||....:.:|      .||...|..:.|   |||.|.......:    |||::    .:|
  Fly   170 SNNSTLPDIKSKKDLDRLMKTKTLKKMHQSKLFKQKERLDKKNNQKKAK----RDRNN----TIK 226

  Fly   132 I-----SKQLFRGE----QYRAERL---EEVRR 152
            .     .|||..|:    :||..|:   :|:||
  Fly   227 SVPKHQRKQLKYGKANQTKYRKGRMVNKKELRR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 19/68 (28%)
Pkinase 102..349 CDD:278497 19/66 (29%)
vitoNP_729096.1 Nop25 2..149 CDD:286843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0601
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.