DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Oxsr1

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001101664.1 Gene:Oxsr1 / 316064 RGDID:1310466 Length:527 Species:Rattus norvegicus


Alignment Length:333 Identity:88/333 - (26%)
Similarity:148/333 - (44%) Gaps:53/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DSSTLPSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQ 141
            |||.||.|..:.:            :|....:|.|:...|.........:..|:| ...|.:.:.
  Rat     4 DSSALPWSINRDD------------YELQEVIGSGATAVVQAAYCAPKKERVAIK-RINLEKCQT 55

  Fly   142 YRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCR-----ESLEQYLLRCQR----IP 197
            ...|.|:|::...: ..|.|.:.:..::...|.|::.|:|..     :.::..:.:.:.    :.
  Rat    56 SMDELLKEIQAMSQ-CHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKGGVLD 119

  Fly   198 EERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGLVI------DVDRANSH 256
            |..|..||.::|.||:.||....||.|:|..|:|:|||. :.::||||:..      |:.|....
  Rat   120 ESTIATILREVLEGLEYLHKNGQIHRDVKAGNILLGEDG-SVQIADFGVSAFLATGGDITRNKVR 183

  Fly   257 HATEGDSRYMAPEILQ---GHFSKAADIFSLGIAMLELAC----YMDLP---------SNGPLWH 305
            ....|...:||||:::   |:..| |||:|.||..:|||.    |...|         .|.|  .
  Rat   184 KTFVGTPCWMAPEVMEQVRGYDFK-ADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDP--P 245

  Fly   306 ELRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHPKLQYLQK-KRKSLMNFSMLSR 369
            .|..|:..:|.:.|.....:.:|...::.||.:||||.:||.|   ::.|| |.|..:...:|.|
  Rat   246 SLDTGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRH---KFFQKAKNKEFLQEKILQR 307

  Fly   370 SFRRSRRA 377
            :...|.|:
  Rat   308 APTISERS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 73/279 (26%)
Pkinase 102..349 CDD:278497 73/277 (26%)
Oxsr1NP_001101664.1 STKc_OSR1_SPAK 15..291 CDD:270787 74/296 (25%)
S_TKc 17..291 CDD:214567 74/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.