DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Raf

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster


Alignment Length:523 Identity:106/523 - (20%)
Similarity:186/523 - (35%) Gaps:200/523 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKHHRLPLPELHDD-----------------KHRHKQCNGE--------------NSNRFRPPK 34
            |:.:::|.|.|..|:                 :.|.::|:..              |..:.|||:
  Fly   273 MDSYYQLLLAENPDNGVGFPGRGTAVRFNMSSRSRSRRCSSSGSSSSSKPPSSSSGNHRQGRPPR 337

  Fly    35 YKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAISFR-----DAGCSD-SSTLPSSPVQAELSTL 93
            ....     |.:|...:..:.:..:.:|::..::..:     ...|:| |::..:||      |.
  Fly   338 ISQD-----DRSNSAPNVCINNIRSVTSEVQRSLIMQARPPLPHPCTDHSNSTQASP------TS 391

  Fly    94 SLSH----------------------FEQCFERLA-------KLGEGSFGEVFQ----------- 118
            :|.|                      .|:.:..||       ::|.||||.|::           
  Fly   392 TLKHNRPRARSADESNKNLLLRDAKSSEENWNILAEEILIGPRIGSGSFGTVYRAHWHGPVAVKT 456

  Fly   119 --VRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRF-----------IRAWE 170
              |:..|..||       |.|:.|   ...|::.|       |.|.:.|           :..|.
  Fly   457 LNVKTPSPAQL-------QAFKNE---VAMLKKTR-------HCNILLFMGCVSKPSLAIVTQWC 504

  Fly   171 QYDRLYMQMELCRESLEQYLLRCQRIPEERIWHILLDLLR----GLKSLHDRNLIHLDIKLDNVL 231
            :...||..:.:.....:              .:.|:|:.|    |:..||.:|:||.|:|.:|:.
  Fly   505 EGSSLYKHVHVSETKFK--------------LNTLIDIGRQVAQGMDYLHAKNIIHRDLKSNNIF 555

  Fly   232 IGEDDETCKLADFGLVIDVDR-ANSHHATE--GDSRYMAPEILQ----GHFSKAADIFSLGIAML 289
            :.| |.:.|:.||||.....| :....|.:  |...:||||:::    ..:|..:|:::.||.|.
  Fly   556 LHE-DLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAFGIVMY 619

  Fly   290 EL--ACYMDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQ----RPTAEQLLSH 348
            ||  .|                  ||...|:.....|..|.:.:::||.:|    .|.|.:.|:.
  Fly   620 ELLAEC------------------LPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQALKRLAE 666

  Fly   349 PKLQYLQKKRKSLMNFSMLSRSFRRSRRAVWGRMCNWKTAAFRYLLYFLE-VLHLCKPI--TASQ 410
            ..::|..|.|                             ..||.||..|| :|.....|  :||:
  Fly   667 DCIKYTPKDR-----------------------------PLFRPLLNMLENMLRTLPKIHRSASE 702

  Fly   411 PNI 413
            ||:
  Fly   703 PNL 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 68/296 (23%)
Pkinase 102..349 CDD:278497 68/294 (23%)
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 73/330 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.