DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Pnck

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_006229634.1 Gene:Pnck / 29660 RGDID:69249 Length:346 Species:Rattus norvegicus


Alignment Length:307 Identity:80/307 - (26%)
Similarity:140/307 - (45%) Gaps:26/307 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FERLAKLGEGSFGEVFQVRDRSDGQLYAVK-ISKQLFRGEQYRAE-RLEEVRRYEEFSGHENCIR 164
            :|...|||.|:|.||...::|....|.|:| |.|:..||::...| .:..:||.    .|.|.:.
  Rat    18 YEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRI----SHPNIVA 78

  Fly   165 FIRAWEQYDRLYMQMELCR--ESLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKL 227
            .....|....||:.|||..  |..::.:.| ....|:...|::..:|..:..||...::|.|:|.
  Rat    79 LEDVHESPSHLYLAMELVTGGELFDRIMER-GSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKP 142

  Fly   228 DNVLIGE--DDETCKLADFGLVIDVDRANSHHATEGDSRYMAPEIL-QGHFSKAADIFSLGIAML 289
            :|:|...  :|....::|||| ..:...|......|...|:|||:| |..:.||.|:::||:...
  Rat   143 ENLLYATPFEDSKIMVSDFGL-SKIQAGNMLGTACGTPGYVAPELLEQKPYGKAVDVWALGVISY 206

  Fly   290 ELAC----YMDLPSNGPLWHELRHGI--LPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSH 348
            .|.|    :.| .|:..|:.::....  ....|.:.||...:..|:.:::.||.:|.|.:|.|.|
  Rat   207 ILLCGYPPFYD-ESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALQH 270

  Fly   349 PKLQYLQKKRKSLMN--FSMLSRSFRRSRRAVWGRMCNWKTAAFRYL 393
            ..:.......:.::.  ...:.::|.|:.   |.|..| .|:..|::
  Rat   271 LWISGDAALDRDILGSVSEQIQKNFARTH---WKRAFN-ATSFLRHI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 72/259 (28%)
Pkinase 102..349 CDD:278497 72/259 (28%)
PnckXP_006229634.1 STKc_CaMKI_beta 14..290 CDD:271071 73/278 (26%)
S_TKc 18..273 CDD:214567 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.