DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Nek8

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001099274.1 Gene:Nek8 / 287473 RGDID:1306897 Length:698 Species:Rattus norvegicus


Alignment Length:260 Identity:65/260 - (25%)
Similarity:129/260 - (49%) Gaps:19/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FERLAKLGEGSFGEVFQVRDRSDGQLYAVK--ISKQLFRGEQYRAERLEEVRRYEEFSGHENCIR 164
            :||:..:|.|:||.|.....::|.:|..:|  ..:|:.:.|:..|:...:|.:   ...|.|.|.
  Rat     4 YERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLK---LLNHPNVIE 65

  Fly   165 FIRAWEQYDRLYMQMELC-RESLEQYL-LRCQR-IPEERIWHILLDLLRGLKSLHDRNLIHLDIK 226
            :...:.:...|.:.||.. ..:|.::: .||.. :.||.|.|..:.:|..|..:|...::|.|:|
  Rat    66 YYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVHTHLILHRDLK 130

  Fly   227 LDNVLIGEDDETCKLADFGLVIDVDRANSHHATEGDSRYMAPEILQGH-FSKAADIFSLGIAMLE 290
            ..|:|:.:.....|:.|||:...:...:..:...|...|::||:.:|. :::.:||::||..:.|
  Rat   131 TQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYE 195

  Fly   291 LACY------MDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHP 349
            ||..      .:||:   |..::..|.. ....::.|.||:.::.|::..:|||||....:::.|
  Rat   196 LASLKRAFEAANLPA---LVLKIMSGTF-APISDRYSPELRQLVLSLLSLEPAQRPPLSHIMAQP 256

  Fly   350  349
              Rat   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 64/258 (25%)
Pkinase 102..349 CDD:278497 64/258 (25%)
Nek8NP_001099274.1 STKc_Nek8 3..258 CDD:270859 65/260 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..307
ATS1 318..663 CDD:227511
RCC1 1 415..466
RCC1 2 467..518
RCC1 3 520..571
RCC1 4 585..636
RCC1 5 638..689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.