DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Map3k4

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_036078.2 Gene:Map3k4 / 26407 MGIID:1346875 Length:1597 Species:Mus musculus


Alignment Length:282 Identity:73/282 - (25%)
Similarity:130/282 - (46%) Gaps:61/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRA--ERLEEVRRYEEFSGHENCIR 164
            ::|..|:|||.:|:|:.......|:|.|:|..:  |:...::.  |..:|::.:|... |.|.:|
Mouse  1332 WQRGNKIGEGQYGKVYTCISVDTGELMAMKEIR--FQPNDHKTIKETADELKIFEGIK-HPNLVR 1393

  Fly   165 FIRAWEQYDRLYMQMELCRE---------SLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNL 220
            :.......:.:|:.||.|.|         .|:::::|.          ....:...:..||:..:
Mouse  1394 YFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRL----------YTKQITVAINVLHEHGI 1448

  Fly   221 IHLDIKLDNVLIGEDDETCKLADFGLVIDVDRANSH------HATEGDSRYMAPEIL-----QGH 274
            :|.|||..|:.: ......||.|||..:.: :.|:.      ::|.|.:.|||||::     :||
Mouse  1449 VHRDIKGANIFL-TSSGLIKLGDFGCSVKL-KNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGH 1511

  Fly   275 FSKAADIFSLGIAMLELACYMDLPSNGPLWHELRHGI-------------LPEEFINKISLELQS 326
             .:||||:|||..::|:     :....| |||..|..             :||    ::|.|.::
Mouse  1512 -GRAADIWSLGCVVIEM-----VTGKRP-WHEYEHNFQIMYKVGMGHKPPIPE----RLSPEGKA 1565

  Fly   327 VIKSMMKPDPAQRPTAEQLLSH 348
            .:...::.||..|.||.|||.|
Mouse  1566 FLSHCLESDPKIRWTASQLLDH 1587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 73/282 (26%)
Pkinase 102..349 CDD:278497 73/282 (26%)
Map3k4NP_036078.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..129
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..465
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1137..1157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1190..1220
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1233..1263
STKc_MEKK4 1331..1590 CDD:270796 73/282 (26%)
S_TKc 1332..1590 CDD:214567 73/282 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.