DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and hhp2

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_593184.1 Gene:hhp2 / 2541929 PomBaseID:SPAC23C4.12 Length:400 Species:Schizosaccharomyces pombe


Alignment Length:399 Identity:92/399 - (23%)
Similarity:151/399 - (37%) Gaps:101/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLE-EVRRYEEFSGHEN--CIRFIRA 168
            |:|.||||:::...:..:|:..|||:.....|..|     || |.|.|....|:..  .||:...
pombe    17 KIGSGSFGQIYLGLNTVNGEQVAVKLEPLKARHHQ-----LEYEFRVYNILKGNIGIPTIRWFGV 76

  Fly   169 WEQYDRLYMQMELCRESLEQYLLRCQRIPEERIWHILLD-LLRGLKSLHDRNLIHLDIKLDNVLI 232
            ...|:.  |.|:|...|||.....|.|....:...:|.| |:..::.:|.::.:|.|||.||.|:
pombe    77 TNSYNA--MVMDLLGPSLEDLFCYCGRKFTLKTVLLLADQLISRIEYVHSKSFLHRDIKPDNFLM 139

  Fly   233 GEDDETCKLADFGLV---------IDVDRANSHHATEGDSRYMAPEILQGHF----SKAADIFSL 284
            .:......:.||||.         :.:...::.:.| |.:||.:   :..|.    |:..|:.||
pombe   140 KKHSNVVTMIDFGLAKKYRDFKTHVHIPYRDNKNLT-GTARYAS---INTHIGIEQSRRDDLESL 200

  Fly   285 GIAMLELACYMDLPSNG--------------------PLWHELRHGILPEEFINKISLELQSVIK 329
            |..:|.. |...||..|                    ||  |:....||||||..:....|  :.
pombe   201 GYVLLYF-CRGSLPWQGLQADTKEQKYQRIRDTKIGTPL--EVLCKGLPEEFITYMCYTRQ--LS 260

  Fly   330 SMMKPDPAQRPTAEQLLSHPKLQYLQKKRKSLMNFSMLSRSFRRSRRAVWGRMCNWKTAAFRYLL 394
            ...||:.|               ||:|..:.|    ::.:.::......|..:...|.||.....
pombe   261 FTEKPNYA---------------YLRKLFRDL----LIRKGYQYDYVFDWMILKYQKRAAAAAAA 306

  Fly   395 YFLEVLHLCKPITASQPNINIVPSSPSSKGVPL-------VPQ----------------VEFQLV 436
            .......:..|:.:....:|  |.:|:...:||       .||                :.|:  
pombe   307 SATAPPQVTSPMVSQTQPVN--PITPNYSSIPLPAERNPKTPQSFSTNIVQCASPSPLPLSFR-- 367

  Fly   437 GSTPIANRD 445
              :|:.|:|
pombe   368 --SPVPNKD 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 72/278 (26%)
Pkinase 102..349 CDD:278497 72/278 (26%)
hhp2NP_593184.1 SPS1 11..353 CDD:223589 88/372 (24%)
PKc_like 11..283 CDD:304357 76/300 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.