DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Mylk4

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_006516731.1 Gene:Mylk4 / 238564 MGIID:3643758 Length:656 Species:Mus musculus


Alignment Length:306 Identity:78/306 - (25%)
Similarity:128/306 - (41%) Gaps:54/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DSSTLPSSP-----VQAE------LSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAV 130
            |....|::|     |.|:      |.|:|.|..         ||.|.||:|.:..:::.|...|.
Mouse   349 DDIPAPAAPFDHRMVMAKHASVDNLYTVSKSEI---------LGGGRFGQVHKCEEKATGLKLAA 404

  Fly   131 KISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCRESLEQYLLRCQR 195
            ||.|.  ||.:.:.:...|:....:.. |.|.|:...|:|....:.:.||.. |..|.:    .|
Mouse   405 KIIKT--RGAKDKEDVKNEISVMNQLD-HVNLIQLYDAFESKHDIILVMEYV-EGGELF----DR 461

  Fly   196 IPEERIWHILLD-------LLRGLKSLHDRNLIHLDIKLDNVL-IGEDDETCKLADFGLVIDVDR 252
            |.:|......||       :..|::.:|...::|||:|.:|:| :..|.:..|:.||||......
Mouse   462 IIDENCNLTELDTILFMKQICEGIRYMHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKP 526

  Fly   253 ANSHHATEGDSRYMAPEILQGHF-SKAADIFSLGIAMLELACYMDLPSNGPLWHE---------- 306
            ........|...::|||::...| |.:.|::|:|:     ..||.|....|...:          
Mouse   527 REKLKVNFGTPEFLAPEVVNYDFVSFSTDMWSVGV-----ITYMLLSGLSPFLGDNDAETLTNIL 586

  Fly   307 -LRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHPKL 351
             .|..:..||| ..||.|.:..|..::..:.:.|.:|.:.|.||.|
Mouse   587 ACRWDLEDEEF-QDISEEAKEFISKLLIKEKSWRISASEALKHPWL 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 66/268 (25%)
Pkinase 102..349 CDD:278497 66/266 (25%)
Mylk4XP_006516731.1 STKc_MLCK4 371..631 CDD:271095 72/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.