DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and ALK

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_004295.2 Gene:ALK / 238 HGNCID:427 Length:1620 Species:Homo sapiens


Alignment Length:508 Identity:110/508 - (21%)
Similarity:183/508 - (36%) Gaps:159/508 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KHRHKQCNGENSNRFRPPKYKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAISFRDAGCSDSST 80
            ||:..|.   .....:.|:||.        :.|..|..:...:.|     :..:.:.:..||...
Human  1062 KHQELQA---MQMELQSPEYKL--------SKLRTSTIMTDYNPN-----YCFAGKTSSISDLKE 1110

  Fly    81 LPSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQ------VRDRSDGQLYAVKISKQLFRG 139
            :|...:     ||           :..||.|:||||::      ..|.|..|: |||...::. .
Human  1111 VPRKNI-----TL-----------IRGLGHGAFGEVYEGQVSGMPNDPSPLQV-AVKTLPEVC-S 1157

  Fly   140 EQYRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMEL-CRESLEQYLLRCQRIPEE---- 199
            ||...:.|.|.....:|: |:|.:|.|....|....::.:|| ....|:.:|...:..|.:    
Human  1158 EQDELDFLMEALIISKFN-HQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSL 1221

  Fly   200 ---RIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETC-------KLADFGLVIDVDRAN 254
               .:.|:..|:..|.:.|.:.:.||.||...|.|:     ||       |:.|||:..|:.|| 
Human  1222 AMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLL-----TCPGPGRVAKIGDFGMARDIYRA- 1280

  Fly   255 SHHATEGDS----RYMAPE-ILQGHFSKAADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPE 314
            |::...|.:    ::|.|| .::|.|:...|.:|.|:.               ||.....|.:| 
Human  1281 SYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVL---------------LWEIFSLGYMP- 1329

  Fly   315 EFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHPK----------LQYLQKKRKSLMNFSMLSR 369
             :.:|.:.|:...:.|..:.||            ||          .|..|.:.:...||:::  
Human  1330 -YPSKSNQEVLEFVTSGGRMDP------------PKNCPGPVYRIMTQCWQHQPEDRPNFAII-- 1379

  Fly   370 SFRRSRRAVWGRMCNWKTAAFRYLLYFLEVLHLCKPITASQPNINIVPSSPSSKGVPLVPQVEFQ 434
                                       ||.:..|    ...|:: |..:.|...| |||.:.|  
Human  1380 ---------------------------LERIEYC----TQDPDV-INTALPIEYG-PLVEEEE-- 1409

  Fly   435 LVGSTPIANRDCYASDFLSGEDPLDLSNQG------SPNVINSTPLNTNQGKS 481
               ..|:..:|      ..|..||.:|.|.      ||......| .|:.||:
Human  1410 ---KVPVRPKD------PEGVPPLLVSQQAKREEERSPAAPPPLP-TTSSGKA 1452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 66/274 (24%)
Pkinase 102..349 CDD:278497 66/272 (24%)
ALKNP_004295.2 MAM 266..427 CDD:279023
MAM 266..424 CDD:99706
LDLa 441..467 CDD:197566
MAM 480..636 CDD:279023
MAM 480..631 CDD:99706
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 650..674
FXa_inhibition 987..1021 CDD:291342
PTKc_ALK_LTK 1109..1385 CDD:270632 77/358 (22%)
Pkinase_Tyr 1116..1383 CDD:285015 76/349 (22%)
Inhibitor binding 1197..1199 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1408..1463 14/57 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1514..1540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.