DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and Map4k3

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_036016462.1 Gene:Map4k3 / 225028 MGIID:2154405 Length:935 Species:Mus musculus


Alignment Length:269 Identity:75/269 - (27%)
Similarity:140/269 - (52%) Gaps:16/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYEEFS 157
            ||..:.::.||.:.::|.|::|:|::.|:.:.|:|.|:|:.| |..||.:...:.|.:...:  .
Mouse     7 LSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIK-LEPGEDFAVVQQEIIMMKD--C 68

  Fly   158 GHENCIRFIRAWEQYDRLYMQMELC-RESLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLI 221
            .|.|.:.:..::.:.|:|::.||.| ..||:........:.|.:|.::..:.|:||..||.:..:
Mouse    69 KHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRETLQGLYYLHSKGKM 133

  Fly   222 HLDIKLDNVLIGEDDETCKLADFGLVIDVDRANSHHAT-EGDSRYMAPEIL----QGHFSKAADI 281
            |.|||..|:|: .|:...||||||:...:....:...: .|...:||||:.    :|.:::..|:
Mouse   134 HRDIKGANILL-TDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDL 197

  Fly   282 FSLGIAMLELA----CYMDLPSNGPLWHELRHGILPEEFINKI--SLELQSVIKSMMKPDPAQRP 340
            :::||..:|||    ...||.....|:...:....|.:..:|:  |......:|..:..:|.:||
Mouse   198 WAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKLKWSNSFHHFVKMALTKNPKKRP 262

  Fly   341 TAEQLLSHP 349
            .||:||.||
Mouse   263 NAEKLLQHP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 71/260 (27%)
Pkinase 102..349 CDD:278497 71/258 (28%)
Map4k3XP_036016462.1 STKc_MAP4K3_like 15..273 CDD:270788 73/261 (28%)
CNH 572..915 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.