DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and cst-1

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001024575.2 Gene:cst-1 / 180708 WormBaseID:WBGene00017472 Length:497 Species:Caenorhabditis elegans


Alignment Length:319 Identity:94/319 - (29%)
Similarity:146/319 - (45%) Gaps:67/319 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 STNSSQIAHAISFRDAGCSDSSTLPSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDR 122
            ||:||:........|....|||.|...|             |:.|:.:.||||||:|.|.:...|
 Worm     4 STDSSRRNSEEGSSDGFKLDSSALNKPP-------------EEVFDIVGKLGEGSYGSVHKAIHR 55

  Fly   123 SDGQLYAVK---ISKQLFRGEQYRAERLEEVRRYEEFSGHENC-----IRFIRAWEQYDRLYMQM 179
            ..|.:.|:|   :...           |:|:  .:|.|..:.|     :::..::.::..|::.|
 Worm    56 ESGHVLAIKKVPVDTD-----------LQEI--IKEISIMQQCKSKYVVKYYGSYFKHSDLWIVM 107

  Fly   180 ELCRESLEQYLLRCQRIP--EERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLA 242
            |.|.......::|.:|.|  |:.|..:|.|.|:||:.|||...||.|||..|:|:..|. ..|||
 Worm   108 EYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDG-IAKLA 171

  Fly   243 DFGLVIDV-DRANSHHATEGDSRYMAPEILQ--GHFSKAADIFSLGIAMLELA----CYMDLPSN 300
            |||:...: |.....:...|...:||||:::  |:.:| |||:||||..:|:|    .|.|:   
 Worm   172 DFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDTK-ADIWSLGITAIEMAEGRPPYSDI--- 232

  Fly   301 GPLWHELRHGIL-----------PEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSH 348
                |.:|...:           |||:    |.|....|:|.:...|.:|.||.:|..|
 Worm   233 ----HPMRAIFMIPTKPPPTFKKPEEW----SSEFNDFIRSCLIKKPEERKTALRLCEH 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 83/277 (30%)
Pkinase 102..349 CDD:278497 83/275 (30%)
cst-1NP_001024575.2 STKc_MST1_2 31..286 CDD:132943 85/292 (29%)
S_TKc 35..286 CDD:214567 83/275 (30%)
Mst1_SARAH 446..493 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.