DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and ire-1

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001254135.1 Gene:ire-1 / 174305 WormBaseID:WBGene00002147 Length:967 Species:Caenorhabditis elegans


Alignment Length:292 Identity:84/292 - (28%)
Similarity:123/292 - (42%) Gaps:54/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LGEGSFGEVFQVRDRSDGQLYAVK-ISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQ 171
            ||.|..|.|. .|...||:..||| :..:..:.....|:.|      .|...|.:.||:......
 Worm   524 LGTGCEGTVV-YRGTFDGREVAVKRVVSEFVKFAHREADLL------RESDTHPHVIRYFCMESD 581

  Fly   172 YDRLYMQMELCRESLEQYLLRCQRIPEERIWHILLDLLR----GLKSLHDRNLIHLDIKLDNVLI 232
            ....|:.:|||..||..|:.  |:..::.:...|.|:::    ||..||...::|.|:|..||||
 Worm   582 SQFRYLALELCIASLNDYVE--QKEVQQNVTIALRDIMKQATDGLAHLHASKIVHRDMKPQNVLI 644

  Fly   233 ------GEDDETCKLADFGLV---------IDVDRANSHHATEGDSRYMAPEIL-QGHFSKAADI 281
                  ||  ....::||||.         |....|:....|:|   ::|||:| ....|...||
 Worm   645 TMASQRGE--MRAVISDFGLCKRVQPGKNSISRGIASGLAGTDG---WIAPEVLISASTSYPVDI 704

  Fly   282 FSLGIAMLELACYMDLPSN----GPLWHELRHGILPEEFINKI------SLELQSVIKSMMKPDP 336
            ||||...     |..|.|.    |...|...:.:..|..:||:      || ...:|.||:..:|
 Worm   705 FSLGCIF-----YYVLTSGTHPFGKSLHRQANIVNGEYTLNKLADLDDWSL-ADDLISSMLNVEP 763

  Fly   337 AQRPTAEQLLSHPKLQYLQKKRKSLMNFSMLS 368
            ..|.||:.:|:||   :.....|.|..||.:|
 Worm   764 LHRLTADAVLNHP---FFWTSEKRLAYFSDVS 792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 77/271 (28%)
Pkinase 102..349 CDD:278497 77/271 (28%)
ire-1NP_001254135.1 Luminal_IRE1 42..311 CDD:188875
PQQ_2 44..232 CDD:290097
PKc_like 515..779 CDD:304357 79/277 (29%)
S_TKc 518..778 CDD:214567 79/276 (29%)
RNase_Ire1 782..907 CDD:199217 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.