DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and PNCK

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001034671.3 Gene:PNCK / 139728 HGNCID:13415 Length:426 Species:Homo sapiens


Alignment Length:321 Identity:85/321 - (26%)
Similarity:142/321 - (44%) Gaps:25/321 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DNNNLNRSQSLGSCSTNSSQIAHAISFRDAGCSDSSTLPSSPVQAELSTLSLSHFE---QCFERL 105
            |::...:....|.......:.|.|.|....|....|.:|:..:|..|  |...|.|   ..:|..
Human    39 DSHRWCKGPGAGPAGPQLREAARASSGLGGGGRHPSRIPAIALQDML--LLKKHTEDISSVYEIR 101

  Fly   106 AKLGEGSFGEVFQVRDRSDGQLYAVK-ISKQLFRGEQYRAE-RLEEVRRYEEFSGHENCIRFIRA 168
            .:||.|:|.||...::|....|.|:| |.|:..||::...| .:..:||.    .|.|.:.....
Human   102 ERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRI----SHPNIVALEDV 162

  Fly   169 WEQYDRLYMQMELCR--ESLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVL 231
            .|....||:.|||..  |..::.:.| ....|:...|::..:|..:..||...::|.|:|.:|:|
Human   163 HESPSHLYLAMELVTGGELFDRIMER-GSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLL 226

  Fly   232 IGE--DDETCKLADFGLVIDVDRANSHHATEGDSRYMAPEIL-QGHFSKAADIFSLGIAMLELAC 293
            ...  :|....::|||| ..:...|......|...|:|||:| |..:.||.|:::||:....|.|
Human   227 YATPFEDSKIMVSDFGL-SKIQAGNMLGTACGTPGYVAPELLEQKPYGKAVDVWALGVISYILLC 290

  Fly   294 ----YMDLPSNGPLWHELRHGI--LPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSH 348
                :.| .|:..|:.::....  ....|.:.||...:..|:.:::.||.:|.|.:|.|.|
Human   291 GYPPFYD-ESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALRH 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 72/262 (27%)
Pkinase 102..349 CDD:278497 72/260 (28%)
PNCKNP_001034671.3 STKc_CaMKI_beta 94..370 CDD:271071 72/264 (27%)
S_TKc 98..353 CDD:214567 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.