DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and AgaP_AGAP004463

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_562218.3 Gene:AgaP_AGAP004463 / 1274610 VectorBaseID:AGAP004463 Length:274 Species:Anopheles gambiae


Alignment Length:198 Identity:38/198 - (19%)
Similarity:75/198 - (37%) Gaps:50/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HHRLPLPEL-HDDKHRHKQCNGENSN-RFRPPKYKTRGYVAVDNNNLNRSQSL----GSCSTNSS 62
            |...|:||| .:||...::...:..| ..:..:..||. :|.:||.:..::.:    .|.:.|||
Mosquito    73 HSYKPIPELTEEDKAEEQEDEYDTENVTVKVVELSTRD-LAKENNWIGENRGMVKDDESDAENSS 136

  Fly    63 QIAHAISFRDAGCSDS--STLPSSPVQAEL-------------STLSLSHFEQCFERLAKLGEGS 112
                     |.|..:.  ..:|...::.|.             |:....:.|...:..||..:|.
Mosquito   137 ---------DDGNDEQQLGVVPGMELEGEKKVKRKHKLSAEEGSSNEAENGESAVKEKAKPKKGP 192

  Fly   113 FGEVFQVRDRSD----GQLYAVKI---------------SKQLFRGEQYRAERLEEVRRYEEFSG 158
            ...:..:|.:.|    .:.||:|.               .|||.:..:.|.::.:.:::.:.|:.
Mosquito   193 VLNLDGIRSKKDLNHKIKRYALKSMKTSQAFRQKTRLQQQKQLKQSRRIRHQKEKHLKQKKGFNK 257

  Fly   159 HEN 161
            |.|
Mosquito   258 HRN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 15/81 (19%)
Pkinase 102..349 CDD:278497 15/79 (19%)
AgaP_AGAP004463XP_562218.3 Nop25 9..154 CDD:286843 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.