DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and AgaP_AGAP006715

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_309028.4 Gene:AgaP_AGAP006715 / 1270343 VectorBaseID:AGAP006715 Length:550 Species:Anopheles gambiae


Alignment Length:275 Identity:73/275 - (26%)
Similarity:119/275 - (43%) Gaps:55/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 ERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMEL------------------CRESLEQYLL 191
            |.|:|::.... ..|||.:.:..::...:.|::.:.|                  ||..:     
Mosquito   100 ELLKEIQAMSS-CNHENVVTYHTSFVVKEELWLILRLLEGGSLLDIIKHRMRTVNCRHGV----- 158

  Fly   192 RCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGLVI------DV 250
                ..|..|..:|.::|:||:..|....||.|||..|:|:| ||.|.::||||:..      |:
Mosquito   159 ----FDEPTIATVLKEVLKGLEYFHSNGQIHRDIKAGNILLG-DDGTVQIADFGVSAWLATGGDL 218

  Fly   251 DRANSHHATEGDSRYMAPEIL-QGH-FSKAADIFSLGIAMLELAC----YMDLPSNGPLWHELRH 309
            .|....|...|...:||||:: |.| :...|||:|.||..:|:|.    |...|....|...|::
Mosquito   219 SRQKVRHTFVGTPCWMAPEVMEQDHGYDFKADIWSFGITAIEMATGTAPYHKYPPMKVLMLTLQN 283

  Fly   310 -------GILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHPKLQYLQKKRKSLMNF--- 364
                   |...::.........:.:|...::.:|.:||||.:||.||..: ..|.||.|...   
Mosquito   284 DPPTIDTGADEKDQYKAYGKTFRKLIGECLQKEPTKRPTASELLKHPFFK-KAKDRKYLTQTLLA 347

  Fly   365 ---SMLSRSFRRSRR 376
               ||.:|..:.::|
Mosquito   348 TGPSMETRVHKAAKR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 63/240 (26%)
Pkinase 102..349 CDD:278497 63/240 (26%)
AgaP_AGAP006715XP_309028.4 STKc_OSR1_SPAK 56..332 CDD:270787 65/242 (27%)
S_TKc 58..332 CDD:214567 65/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.