DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and AgaP_AGAP013266

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_003436241.1 Gene:AgaP_AGAP013266 / 11175450 VectorBaseID:AGAP013266 Length:1140 Species:Anopheles gambiae


Alignment Length:208 Identity:59/208 - (28%)
Similarity:97/208 - (46%) Gaps:29/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LYMQMELC-RESLEQYL-LRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDE 237
            ||:||:|| ::||:::| |.......::|..|...::.|::.:|.:.|||.|:|..|:....|..
Mosquito   869 LYIQMQLCHKQSLKEWLSLNGFPARRDKIVPIFEQIVAGVEYVHLKGLIHRDLKPSNIFFSLDGR 933

  Fly   238 TCKLADFGLVID-----VDRANS--------HHATEGDSRYMAPEILQG-HFSKAADIFSLGIAM 288
             .|:.|||||.|     .|..|:        |....|...||:||.|:| .:....||:|||:.:
Mosquito   934 -IKIGDFGLVTDSSDLQYDSENNMPTMVPNRHTRQVGTQLYMSPEQLKGLPYDYKVDIYSLGLIL 997

  Fly   289 LELACYMDLPSNGPLWHEL------RHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLS 347
            .||     |.|.|.....:      |....|:.|......|.: ::..|:...|.:|||...:.:
Mosquito   998 FEL-----LVSFGTEMERICTLKNVRKSKFPDNFEEDHECEFK-LLSLMLSEAPNKRPTTFGIKA 1056

  Fly   348 HPKLQYLQKKRKS 360
            ||..:.:...:.:
Mosquito  1057 HPPFKRIPSNKST 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 57/195 (29%)
Pkinase 102..349 CDD:278497 57/195 (29%)
AgaP_AGAP013266XP_003436241.1 Luminal_EIF2AK3 20..339 CDD:188874
PKc_like 537..>630 CDD:304357
S_TKc <865..1060 CDD:214567 59/197 (30%)
STKc_EIF2AK <867..1051 CDD:270898 56/188 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.