DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myt1 and LOC108647618

DIOPT Version :9

Sequence 1:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_031758734.1 Gene:LOC108647618 / 108647618 -ID:- Length:211 Species:Xenopus tropicalis


Alignment Length:220 Identity:62/220 - (28%)
Similarity:90/220 - (40%) Gaps:63/220 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 GLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGLVIDVDRANSHHAT---EGDSRYMAPEIL- 271
            ||:.||.|.:||.|:|.||:||..:.. .|:|||||.  |:....|..|   .|..:|||||:| 
 Frog     4 GLQYLHSRGIIHCDLKPDNILISSEGH-IKIADFGLA--VEHVFGHDTTCGYRGTPKYMAPEVLA 65

  Fly   272 QGHFSKAADIFSLGIAMLELACYMDLPSNGPLWHEL--RHGILPEEFINKISLELQSVIKSMMKP 334
            ...::.|.|.::.||.:.::|       .|  |:..  :||              .:.::..:..
 Frog    66 DQRYNAAVDWWAFGIILCQMA-------TG--WYPFDDKHG--------------DAALRHSILE 107

  Fly   335 DPAQRPTAEQLLSHPKLQYLQKKRKSLMNFSMLSRSFRRSRRAVWGRMCNWKTAAFRYLLYF--- 396
            |.|:.||    .:..||..|.:|         |.|....||..|.|.:        |..|:|   
 Frog   108 DKAKVPT----WTPSKLVILLRK---------LLRKKACSRYGVKGNI--------RQCLFFDSI 151

  Fly   397 ----LEVLHLCKPI---TASQPNIN 414
                ||...|..|.   ...||.:|
 Frog   152 DWEALENGRLPPPFQLEALQQPAVN 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 42/143 (29%)
Pkinase 102..349 CDD:278497 42/143 (29%)
LOC108647618XP_031758734.1 PKc_like <1..207 CDD:419665 62/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063695at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.