DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scny and UBP16

DIOPT Version :9

Sequence 1:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_015253.1 Gene:UBP16 / 856032 SGDID:S000005993 Length:499 Species:Saccharomyces cerevisiae


Alignment Length:465 Identity:93/465 - (20%)
Similarity:159/465 - (34%) Gaps:161/465 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KQSERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWLVSEQAHLADCNV-------------- 212
            |||..|:.. .|:||.||.|::.|:||.|..||....:|...:..|.:...              
Yeast    44 KQSIGKYTT-VGLINRGNDCFITSSLQGLAGIPRFVEYLKRIRTVLLELETKLSNNAKGDNPTVD 107

  Fly   213 -------AEPGSGCI------ICAMTKTLLATQSNQSAVRPFLIYSKLKQICKHMVVGRQEDAHE 264
                   .|..|..:      :.::...|::.:..::::.|.::.:.|:.|.|..:..:|.||||
Yeast   108 NTTRHSRLENSSNSLAPLHESLTSLILDLISVKDRKTSISPKIVINTLESIFKSKISSKQNDAHE 172

  Fly   265 FLRFLVEAM--ERAYLMRFRNYKELDQLVKETTPLGQIFGGYLRSEVRCLSCNHVS-----ITFQ 322
            |...|::.:  ||:.|:.:.  |::..|.....|    |.|.....:.||.|..:|     .|| 
Yeast   173 FTLILLQTLQEERSKLIDYS--KQICNLNIPKFP----FEGETSKFLVCLKCKGLSEPSYKQTF- 230

  Fly   323 HFQDLLLDIRKADSLEDAFEGHFSRERLEDMGYKCEGC--------------------------K 361
             .::|.:..:.:::|.:.. .|...|.::|  |.|..|                          :
Yeast   231 -IRELSVPQQTSENLSNIL-AHDETEIIDD--YSCLICQIRAILNHEEYRNFKDCTPDEILMLDR 291

  Fly   362 KKVSATKQFSLERAPITLCIQLKRFSM-------IGNKLTKQ----------------------- 396
            .|..|||....|..|..:...:||:|.       |..|:.|:                       
Yeast   292 LKNYATKAPINENLPFEVEQYVKRYSKGNLQVSNIKGKVIKKDVVVQLPDILIVHLSRSTFNGIT 356

  Fly   397 -------ISFKSRIDLSKY--AARSQAAQAQPLTYRLVSMVTHLGASQHCGHYTA--------IG 444
                   :.|..||.||:|  |......:.:.:.|.|.|:|.|.| |...|||..        .|
Yeast   357 YSRNPCNVKFGERITLSEYTLAESGTITENRQVKYNLKSVVKHTG-SHSSGHYMCYRRKTEIRFG 420

  Fly   445 STDTGSF---------------------------------------YNFDDSYVRPIAMHSVCNT 470
            ..|..||                                       :...|:.::.....:|.|.
Yeast   421 KEDESSFRRAPVVNNEVNKNREQNVAHNDYKKSRYKKVKNALRYPYWQISDTAIKESTASTVLNE 485

  Fly   471 N--AYIMFFE 478
            .  ||::::|
Yeast   486 QKYAYMLYYE 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 88/453 (19%)
UCH 172..477 CDD:278850 88/452 (19%)
Asp-B-Hydro_N <617..>731 CDD:191249
UBP16NP_015253.1 Peptidase_C19F 54..495 CDD:239127 88/452 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.