DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scny and USP44

DIOPT Version :9

Sequence 1:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster
Sequence 2:XP_005269229.1 Gene:USP44 / 84101 HGNCID:20064 Length:743 Species:Homo sapiens


Alignment Length:629 Identity:142/629 - (22%)
Similarity:208/629 - (33%) Gaps:218/629 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KRILMAKI---EYEEVPNYHESVLENLKSKYIVIKPGNPGAINGFSGKNNTGKLVGANGHDNNGA 115
            :||||.||   .:|:.|...:...|..:.|.:|              |....|           .
Human   154 RRILMGKIFRTWFEQSPIGRKKQEEPFQEKIVV--------------KREVKK-----------R 193

  Fly   116 RKQAEH----------PNN--------QSHHINHHNHQHPTSNPNELPKPKRVLYPRENIRIGWK 162
            |::.|:          |..        ||..|...:.|.|...|.. |...:||...|| .|..|
Human   194 RQELEYQVKAELESMPPRKSLRLQGLAQSTIIEIVSVQVPAQTPAS-PAKDKVLSTSEN-EISQK 256

  Fly   163 QSE----RKWQVG---TGMINVGNTCYLNSTLQALLHIPA---------LANWL---VSEQA--- 205
            .|:    |:..|.   ||:.|:|||||:||.||.|.|:..         |..||   .||:.   
Human   257 VSDSSVKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQCFLKLDLNQWLAMTASEKTRSC 321

  Fly   206 -----------HLADCNVAEPGSGC---------------------------------IICAMTK 226
                       .:.:|...:.|..|                                 .:|....
Human   322 KHPPVTDTVVYQMNECQEKDTGFVCSRQSSLSSGLSGGASKGRKMELIQPKEPTSQYISLCHELH 386

  Fly   227 TLLAT--QSNQSAVRPFLIYSKLKQICKHMVVGRQEDAHEFLRFLVEAMERAYLMRFRNYKELD- 288
            ||...  ....:.|.||.:...:.::........|:||.|||..|::.::|          ||: 
Human   387 TLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYAQQDAQEFLCELLDKIQR----------ELET 441

  Fly   289 --------------QLVKET-TPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLL--------- 329
                          :|:|:. ..:..||.|.|.|:|.||:|::.|.|.:.|.||.|         
Human   442 TGTSLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCLACDNKSNTIEPFWDLSLEFPERYQCS 506

  Fly   330 --DIRKADSLEDAFEGHFSR-ERLEDMGYKCEGCKKK-----------VSATKQFSLERAPITLC 380
              ||.....|.......|:. |.||...|.|:.|..|           ..|.||..:...|..|.
Human   507 GKDIASQPCLVTEMLAKFTETEALEGKIYVCDQCNSKRRRFSSKPVVLTEAQKQLMICHLPQVLR 571

  Fly   381 IQLKRFS----------------------------MIG-------NKLTKQISFKSRIDLSKYAA 410
            :.|||||                            :.|       .|:...:.|:..:::..|..
Human   572 LHLKRFSTNSLCILINTLLAMLRSSNGKYDQQTEKITGWSGRNNREKIGVHVGFEEILNMEPYCC 636

  Fly   411 RSQAAQAQP--LTYRLVSMVTHLGASQHCGHYTAIGSTDTGSFY-NFDDSYVRPIAMHSVCNTNA 472
            |......:|  ..|.|.::|.|.|.....|||||......|.|: :.:||.:....|..||...|
Human   637 RETLKSLRPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMCTMDEVCKAQA 701

  Fly   473 YIMFFELDLSQAASPAANRPNGVRLTNGHSTTPVPAATVSSPSP 516
            ||:|:...:::               ||||....|...:.|..|
Human   702 YILFYTQRVTE---------------NGHSKLLPPELLLGSQHP 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 102/446 (23%)
UCH 172..477 CDD:278850 102/442 (23%)
Asp-B-Hydro_N <617..>731 CDD:191249
USP44XP_005269229.1 zf-UBP 29..90 CDD:280334
UCH 272..706 CDD:278850 102/443 (23%)
Peptidase_C19 274..707 CDD:271592 102/442 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.